Conserved Protein Domain Family
TMF_TATA_bd

?
pfam12325: TMF_TATA_bd 
TATA element modulatory factor 1 TATA binding
This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes. The proteins bind to the TATA element of some RNA polymerase II promoters and repress their activity. by competing with the binding of TATA binding protein. TMF1_TATA_bd is the most conserved part of the TMFs. TMFs are evolutionarily conserved golgins that bind Rab6, a ubiquitous ras-like GTP-binding Golgi protein, and contribute to Golgi organisation in animal and plant cells. The Rab6-binding domain appears to be the same region as this C-terminal family.
Statistics
?
PSSM-Id: 403516
View PSSM: pfam12325
Aligned: 78 rows
Threshold Bit Score: 84.9031
Threshold Setting Gi: 195164273
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EMR69183     661 SVSTAGAGPSVQLVERMSAAIRRLESEKVAAKEELARISSQRDEARAEIVTLMREIESGKAATSKVESLEKEVEEINERY 740 Eutypa lata UCREL1
Q6FK79       489 TRNSTQMQSNAQLVTKLGHEIGRLETEIQSHREKIERLQKEKQLANDEILKLIDKNNGLSSIKLEKEELEKQVRDLQEKL 568 [Candida] glabrata
P47166       585 QLSNSNGHISAHLVNKLSTELKRLEGELSASKELYDNLLKEKTKANDEILRLLEENDKFNEVNKQKDDLLKRVEQMQSKL 664 Saccharomyces c...
XP_002495321 568 TQVDSTGQMNAHMISKLGAEIRRYEAELVSLQNSCERLQKEKMEASNEILKLLEDNERVQVLSKEKDELTRKLEETQSKL 647 Zygosaccharomyc...
XP_003672427 637 STNTNAQIMNAQMLSRLGSEIRCMEGEYRSLKESYDRLQAEKNNANEEILKLLKSNEDCTRLNEENTKLKSEIDQLHHKL 716 Naumovozyma dai...
CCC72199     585 lSNASNTQMNSQMMSRLGSEIRRIEGEYAALEETYTRLKKEKDNANDEILRLLEENEGVKSIKEENLKLKTQIESVNQKL 664 Naumovozyma cas...
CCE65381     609 natPNQSQFNAQLVTKLGTEIRRLESEISSLTEANNRLQAEKSNTNAEILKLLEENDATKKLKDEYTKIQNQYKDVENKL 688 Tetrapisispora ...
XP_002553474 558 VKPSQNSQMNAQMVSRLGSQIRRLETELASLKDSNSRLLKEKQNINDTIVKLMEENSNANKTKSQLKESLAHSDALEKKL 637 Lachancea therm...
EDO16050     600 QNQSSNTQLNSHMVSRLGAELRRMETEMLSLKDTNERLQKEKMKSNNEIVRLLEENDKLNKLPDENLKLEKNVATLESKL 679 Vanderwaltozyma...
CCK69103     555 SNAASAQQINTQLVSRLGSEVRRLESELSSLQQAYETLQEEKDASNSEILKLMEENDETKKIKLKNEDLQRQVTTLQAQL 634 Kazachstania na...
EMR69183     741 QTTLEMLGEKSEQVEELRADITDVKTMYRDLVEQT 775 Eutypa lata UCREL1
Q6FK79       569 DTSLQILGEKTERVEELQNDVLDLKDMLHEQVKQM 603 [Candida] glabrata
P47166       665 ETSLQLLGEKTEQVEELENDVSDLKEMMHQQVQQM 699 Saccharomyces cerevisiae S288C
XP_002495321 648 ETSLQILGEKTERVEELENDVADLKEMMQQQVQQM 682 Zygosaccharomyces rouxii
XP_003672427 717 ETSLQLLGEKTETVDELKNDVDDLKEMLHQQVQQM 751 Naumovozyma dairenensis CBS 421
CCC72199     665 ETALQLLGEKTEAAEELQNDVEDLKEMLHQQVQQM 699 Naumovozyma castellii CBS 4309
CCE65381     689 ETSLIILGEKTEQVEELKNDVEDLKEMIRDQAQQM 723 Tetrapisispora phaffii CBS 4417
XP_002553474 638 NATLQLLGERSERVEELENDVDDLKELMQMQVQQM 672 Lachancea thermotolerans CBS 6340
EDO16050     680 EVSLQLLGEKTECVEELQNDVADLKEMMREQVNQM 714 Vanderwaltozyma polyspora DSM 70294
CCK69103     635 ETALQLLGEKTERVEELENDVEDLKEMMQQQVQQM 669 Kazachstania naganishii CBS 8797
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap