Conserved Protein Domain Family
HTH_15

?
pfam12324: HTH_15 
Helix-turn-helix domain of alkylmercury lyase
Alkylmercury lyase (EC:4.99.1.2) cleaves the carbon-mercury bond of organomercurials such as phenylmercuric acetate. This is the N terminal helix-turn-helix domain associated with pfam03243.
Statistics
?
PSSM-Id: 372044
View PSSM: pfam12324
Aligned: 6 rows
Threshold Bit Score: 87.5056
Threshold Setting Gi: 311312946
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_013673492            7 QLVAQLADALyGTGHPATQPWLFRPLLRLLAEGEPVTLDRLAEAAGTSVDQVRQALAAEPDTEYDADGRVVGLG 80  Amycolatopsi...
VBC:MMAR_p10            7 QLAHRLNDSL-GGDNPGSTPWMLRPLLDLLAHGAPVTIDQLADATATTVEQVRHALTAMSDTEYDEHGRIIGSG 79  Mycobacteriu...
CCX13273               62 ELVTLFDQN--KGEGGGSMKWLFRPLLQMLTKGEPVTVEDIATTTGKPLDEVKDILSTLSSVELDEQGRVVGFG 133 Pyronema omp...
WP_013020577            7 rFDTWLSTSLaDSEVGGGAWTIARSIQKLLLDGKPVPVAGLAAETGRSVEEVEQALEAMPSVEREPDGTVVGFG 80  Stackebrandt...
calssnu:BYI23_E002720   6 msptTYIEHFpSISRSQDSAELLVALLRELAKGRPVSRTTLAGILNWPDERIAAVLAQTASTEYDDDGNIIGHG 79  Burkholderia...
EFQ82857                3 DLSSQLPQRLtRPEETGLDAGLLIPLLRLLVDGDAVTVEELAAAAGRTLEEVRRGLAAVPDTEYD-QGRIIGQG 75  Aeromicrobiu...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap