Conserved Protein Domain Family
NeA_P2

?
pfam12312: NeA_P2 
Nepovirus subgroup A polyprotein
This family of proteins is found in viruses. Proteins in this family are typically between 259 and 1110 amino acids in length. The family is found in association with pfam03688, pfam03689, pfam03391. This family is one of the polyproteins expressed by Nepoviruses in subgroup A.
Statistics
?
PSSM-Id: 372036
View PSSM: pfam12312
Aligned: 4 rows
Threshold Bit Score: 213.672
Threshold Setting Gi: 81949696
Created: 21-May-2020
Updated: 6-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ACR48168    1 MGKfyyssrrlacwaagknphlggsveqwlaaietdpsfrqtvked-------vqlnrerldairmfswklgygpidnpe 73   Grapevine fanleaf...
Q8JN27     60 LRQ----------------------------------------------------------------------------- 62   Arabis mosaic virus
Q6JX05      1 MGKfyfsdrrlaayclgtdgrgtfeqwlqcmedpsfrkevkervq--------fdravpsvsrifeypvgrgpvegpagi 72   Grapevine deforma...
BAF35851    1 MVKfyysnrrlvcwavsknlhlggsveqwlqcvedsafraevksdvvanrdhptairtfsykvgygpiddpryadwgyvl 80   Arabis mosaic virus
ACR48168   74 kcnwhfvltgevsaqPTQPVKADEVVGVPQpKkvVIPSPPPPPA-PYFRAVGAFAPTRSGFIRATVERLTREREESRAAA 152  Grapevine fanleaf...
Q8JN27     63 ---------------PIEPVKAQEVVVPPV-K--VIPSPPPVPR-PYFRPIGAFAPTRSGFIRATVERLTREREESRAAA 123  Arabis mosaic virus
Q6JX05     73 awhyivhghslglvpPTQPAKADEVVV-PQpKkvVIPLPPPAPK-PYFRPVGAFAPTRSGFIRATVERLSREREESRAAA 150  Grapevine deforma...
BAF35851   81 tgvatpglrggvvppPTEPVKAHEVVEVPQpRv-EIPSPPPVPTyTLYRSVGAFAPTRSGFIRAIVERLRRKRAESTAAA 159  Arabis mosaic virus
ACR48168  153 LFAELPLEYPQGAPLKLSLAmkFAMLK---HTTWRKWYDTSDERLLEAHPGGPCL---PPPPPIQSPPSFYERRREFCRV 226  Grapevine fanleaf...
Q8JN27    124 LFAELPLEYPQGAPLVVPRG--FAAMRwtyHTTWRRWYDTSDERAMRVHPGGPALpppPPPPPIQKPPSFEERLQTALQR 201  Arabis mosaic virus
Q6JX05    151 LFAELPLEFPQGAPLRLSLAvkFAMLK---HTTWRKWYDTSDERLLEAHPGGPCL---PPPPLIQNPPSFCERVREFCRM 224  Grapevine deforma...
BAF35851  160 LFAELPLEYPQGAPLKLTVIqkMGMVR---YQSWKLWYDTSDARISGHYKGVSPFpppPPPP---KPLTFREKLAAACSR 233  Arabis mosaic virus
ACR48168  227 KSCARAFALETSLGLNRAWVGLVDIPSTSVCC 258  Grapevine fanleaf virus
Q8JN27    202 QFCTRAFALETSLGLNVAWVEMATIPSISICC 233  Arabis mosaic virus
Q6JX05    225 KSCARAFALETSLGLNKAWVGYVDIPSISVCC 256  Grapevine deformation virus
BAF35851  234 QVSGRIFSFQTSLGLNMAQTCRVAIPSISICC 265  Arabis mosaic virus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap