Conserved Protein Domain Family
Noelin-1

?
pfam12308: Noelin-1 
Neurogenesis glycoprotein
This domain family is found in eukaryotes, and is approximately 100 amino acids in length. The family is found in association with pfam02191. There are two conserved sequence motifs: SAQ and VQN. Noelin-1 is a glycoprotein which is secreted mainly by postmitotic neurogenic tissues in the developing central and peripheral nervous systems, first appearing after neural tube closure. It is likely that it forms large multimeric complexes.It has a divergent function in neurogenesis. In animal caps neuralized by expression of noggin, co-expression of Noelin-1 causes expression of neuronal differentiation markers several stages before neurogenesis normally occurs in this tissue. Finally, only secreted forms of the protein can activate sensory marker expression, while all forms of the protein can induce early neurogenesis.
Statistics
?
PSSM-Id: 403504
View PSSM: pfam12308
Aligned: 8 rows
Threshold Bit Score: 148.002
Threshold Setting Gi: 260819750
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_003457800  52 PGSEEGWQVYSTASdpdGRCVCTVVAPARNLCKRDPRSRQLRSLTEQVQNVSQSMEVVDLRTSRDLQYVRDSEPLLRGVD 131 Nile tilapia
NP_998425     51 PGQDEGWQVYGSAQ---GRCVCSIKTPVPDACAGDPRHTRLQQISAHVLNVSEHMQLLTRRTAGDLQELRSSETILDTLE 127 zebrafish
XP_002605199  31 hgSRDTYYVHSTSEdtsGHCTCTVLAPSPDVCSDDAKYHYIKDLEAQVANLTTLVHQLANRTSSALD-IQTTMTLIHNLT 109 Florida lancelet
XP_015204534  23 PSPEEGWQIYSSAQdpdGKCVCTVVAPAQSMCTRDPRSRQLRQLMEKVQNISQSMEVLHLRTERDLQYITKTGSLVSEVN 102 spotted gar
CAF90025       5 SVPEENWQVYSSAQdsdGRCVCTVVAPQQTVCSRDARTQQLKHLLEKVQNMSHSIEILDQRTQRDLKFVENMEFQLKTLE 84  spotted green p...
XP_012418194   3 ISPKEGWQVYSSAQdpdGRCICTVVAPEQNLCSRDAKSRQLRQLLEKVQNMSQSIEVLNLRTQRDFQYVLKMETQMKGLK 82  Pacific walrus
ELK17866       9 QSPEEGWQLYTSAQapdGKCICTAVIPAQSTCSRDGRSRELRQLMEKVQNVSQSMEVLELRTYRDLQYVRSMETLMRSLD 88  black flying fox
XP_016426775  52 PSPEEGWQIYSSAQdadGKCICTVVAPAQNMCNRDPRSRQLRQLMEKVQNITQSMEVLDLRTYRDLQYVRDTENLMKTVD 131 Sinocyclocheilu...
XP_003457800 132 GRLHTYVANPRTLTARSLQE 151 Nile tilapia
NP_998425    128 KTLTSAQQNPQELSDRSLQE 147 zebrafish
XP_002605199 110 SQLDVLEADRQLLLTeyfsg 129 Florida lancelet
XP_015204534 103 SKLKVASESTRTLDPKSFQE 122 spotted gar
CAF90025      85 NKFKDVEDGHESNTARQYKs 104 spotted green pufferfish
XP_012418194  83 AKFRQIEDDRKTLMTKHFQE 102 Pacific walrus
ELK17866      89 ARLRGADG---SLSAKSFQE 105 black flying fox
XP_016426775 132 GKLKTASENPRSLNPKSFQE 151 Sinocyclocheilus rhinocerous
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap