Conserved Protein Domain Family
DUF3631

?
pfam12307: DUF3631 
Protein of unknown function (DUF3631)
This protein is found in bacteria. Proteins in this family are typically between 180 to 701 amino acids in length.
Statistics
?
PSSM-Id: 403503
View PSSM: pfam12307
Aligned: 28 rows
Threshold Bit Score: 217.516
Threshold Setting Gi: 296180973
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EHR48915       262 HMKRRRADEHVAEFWEEDVEHQARPLRETLAAWMESVAEQVGRA-RPTMPdgVRDRPAEIWRPLIAIADAAGDHWPNTAR 340 Saccharomonos...
Q8XWJ1         553 QMRRKMPHETAERLRHA-EPDLFDTLCAKLARWADDNGDAIRVA-RPNLPdaLGDRDQDNWEPLLAVADLAGGTWPDYAR 630 Ralstonia sol...
WP_013966099    97 eLRRKRPDEKVDRLRYA-EPLLFEGFTAQLARFAEDYSNAIRQN-RPILPdeLGDRDQDNIEPLLQVAYVAGGHWPDTST 174 Nitrosomonas ...
jgi:Despr_0756  94 eLRRKLPHEEVDRLRYA-GPDLFSTLQEKLTRFANDYSEQVRRT-RPPLPscLNDRAQDNWEPLLAIAMVAGGQWLEIGT 171 Desulfobulbus...
jgi:Despr_0482 573 eLRRKLPHESVDRLRYA-EPNLFHNLRSRLARFAEDYSEKVRQA-RPPLPasLNDRAQDNWEPLLAIAMVAGGQWLEIGT 650 Desulfobulbus...
BAN50678       255 RLRRRTPGENVESLRHS-DPALWDCLRARLARFALDSAEAISKA-RPTPIpgLNDRANDAWEPLLAIADLVGEHWPKMAR 332 Pseudomonas r...
WP_013331422   272 eLRRKMPHETVENIRFM-PPELRQRLQQQLARLHEDLADTVAAA-RPTPVpgLSNRAADNWEPLKQIADAVGGEWPERLK 349 Halomonas elo...
BAI97994       183 RMRKRAAGEKAEPFQPRIHELQAEALRIELAEWAASIAGLAEMA-QPAMPdcIADRNADVWGPLFAVADLAGGTWPEAVR 261 Sphingobium j...
CCP45453       195 RMRRRAPTEPVEPWRPRVNGPEAEKLHDRLANWAAAINPLESG--WPAMPdgVTDRRADVWESLVAVADTAGGHWPKTAR 272 Mycobacterium...
WP_011778709   190 RMRRRAPDEHIEPWRLRVNGGEAEKLRNWLAAWAVSVADRLTGDfWPDIPaeVTDRDADVWEALLAVADLAGGDWPERAR 269 Mycolicibacte...
EHR48915       341 AACNHFVAHAATQP--DSIGIRLLADLQTLFAARDTDRMATAEILTALHEQDEAPWSE-LQGRPLDARRLGRLLGKYGVK 417 Saccharomonos...
Q8XWJ1         631 GAALKLCNRG--GEaaQSTGAELLADIQAVFDRKGMQRISMADLLAALCEDDEAPWKTwNRGKEMTTRQLGKKLGEYGIK 708 Ralstonia sol...
WP_013966099   175 KAALKI-FKA--SQsnQSTANELLADIQETFETKHISKISTADLIETLVSDDEKSWATyNRGKPITPRQLASKLRDYSIY 251 Nitrosomonas ...
jgi:Despr_0756 172 RAAVKL-SGG--GNpvETIGIELLADIKEIFEMNERDRISTADLIRALCDNDEKAWATyNRGNPISPRQLANKLKGYGIT 248 Desulfobulbus...
jgi:Despr_0482 651 SAALKL-SGT--ESaaQTIGTELLADIQEIFEARDTDRISTADLIKALCEDDEKVWSTyNRGNPIKPRQLANKLKGYGIS 727 Desulfobulbus...
BAN50678       333 NAAITL-HGL--EGeaPSIGAELLADVKVVFDDKRALKIFGADLLNALIADEEAPWATwNRGKPMSPRQFSAKLTDFGIK 409 Pseudomonas r...
WP_013331422   350 AVAITV-TRMDDEEqaSDVGTELLKDIKGVFEEKKANSIFTADLTEALWADSEAPWNTwNRGKPMSARQLSAKLADFGVR 428 Halomonas elo...
BAI97994       262 MAATDAVLSAKASEr-PSLGAQLLADIHACF--GNADRITTVDLLDRLLDDDEAPWGD-LRGRKIDARKLAEMLREYGIR 337 Sphingobium j...
CCP45453       273 ATAETDATANRGAK--PSIGVLLLRDIRRVF--SDRDRMRTSDILTGLNRMEEGPWGSiRRGDPLDARGLATRLGRYGIG 348 Mycobacterium...
WP_011778709   270 VAAVALVAASKQRA--PSVGVLLLRDIRTVLSKANGDGMATEHLLAELNEMDESPWSTiRRGEPIDSRGLAQRLNKYGIS 347 Mycolicibacte...
EHR48915       418 SRDIKPTGGTAVKGYrldGDGGLADAWSRY 447 Saccharomonospora marina XMU15
Q8XWJ1         709 SKVVRIGYD-APKGF---DVDQFSDAFARY 734 Ralstonia solanacearum
WP_013966099   252 SKTVRLGYE-TAKGF---ELDQFTDVFERY 277 Nitrosomonas sp. Is79A3
jgi:Despr_0756 249 STTLRFRHTGLAKGY---ERKQFEEAFSRY 275 Desulfobulbus propionicus DSM 2032
jgi:Despr_0482 728 SNTIRLGIT-TPKGF---MRDQFSEAFSRY 753 Desulfobulbus propionicus DSM 2032
BAN50678       410 SKDVRLGLE-VKKGY---HLEQFTDAFGRY 435 Pseudomonas resinovorans NBRC 106553
WP_013331422   429 SKQIRIGSS-TKKGY---RKEDFKDAFDRY 454 Halomonas elongata
BAI97994       338 SSTIRMPNGQTPKGY---KREAFHDAWKRY 364 Sphingobium japonicum UT26S
CCP45453       349 PKFQHSGGEPPYKGY---SRTQFEDAWSRY 375 Mycobacterium tuberculosis H37Rv
WP_011778709   348 SK--QHVGDRGVRGY---TRAQFEDAWKRY 372 Mycolicibacterium vanbaalenii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap