Conserved Protein Domain Family
BCLP

?
pfam12304: BCLP 
Beta-casein like protein
This protein is found in eukaryotes. Proteins in this family are typically between 216 to 240 amino acids in length. This protein has two conserved sequence motifs: VLR and TRIY. BCLP is associated with cell morphology and a regulation of growth pattern of tumor. It is found in adenocarcinomas of uterine cervical tissues.
Statistics
?
PSSM-Id: 403500
View PSSM: pfam12304
Aligned: 29 rows
Threshold Bit Score: 170.125
Threshold Setting Gi: 525021562
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q53RY4        19 MRVGLALILVGHVNLLLGAVLHGTVLRHVANPRGAVTPEYTVANVISVGSGLLSVSVGLVALLASRNLLRPPLHWVLLAL 98  human
XP_022528700   1 MAKGLTLIVIGHINFILGAIVHGSILRHISKPSGKISTEYTVSNIIAVTSGLLSIASGIVAILVSRNITNWKLHVGLLVS 80  Mexican tetra
XP_003200362  14 MKKGLTLIVIGHVNFILSAIVHGSVLRHVSKPSNEISTEYTVSNIISVSSGLLSIGSGIVAILVSRNIANWKLHIGLLVS 93  zebrafish
Q4RKP6        14 MRAGLTLILVGHINFILGAIVHGSVLRHISKPSSRITTQYTVDNIFSVTSGLLSILTGIIAILMTRNLRLKKLQVGLAVS 93  spotted green p...
XP_005995638  20 MKTGLALIVVGHINFILGAIVHGSILRHLSQPKHGVATEYFSSNILAAASGILSICCGISAIVLSRNLNRKSLRWTLLVM 99  coelacanth
XP_002940070  17 MKLGLILIVIGHLNFIIGAIVHGLVLRHLAQLQDAVAMQYSVANITAVVSTILSITCGITAIVLSRYLEHVPLRWTVLVL 96  tropical clawed...
XP_007669943 118 MKTGLVLIVLGHISFIAGALVHGMVLRYMMDTHDAVTLQYSISNILAVTSALLIISCGITAIVLSRYLSRTPLRWAVFIM 197 platypus
XP_005317826  18 MKTGLVLVVLGHVSFIIAAVLHGTVLRYVAAPRDAVALQYCVVNILSVTSAIVVITSGIAAIVLSRYLPSTPLRWTMFSS 97  thirteen-lined ...
XP_001381418  18 MKTGLVLLVLGHISFIAGALLHGTALRYVTDPQDAVSLQYAVSNILAVTSAILIITCGITVIVLSRYLSLTSLRWTVFAA 97  gray short-tail...
XP_003228791  17 MKTGLILIVIGHLNFITGALVHGTVLRHIANPRDTISLQYAVSNIVTVVSAILTISCGIAAIVLSRYISRKPLAWAVFSL 96  green anole
Q53RY4        99 ALVNLLLSVACSLGLLLAVSLTVANGGRRLIADCHPGLLdplVPldEGPGHTDCPFDPTRIYDTALALWIPSLLMSAGEA 178 human
XP_022528700  81 SFLNTLLSTACCVGLLLAISLTIKADGSALMQGCNSTGMp-iNA--RSPINANCPFDTTRIYDTTLSLWFPCTLLSAMET 157 Mexican tetra
XP_003200362  94 SFLNALLTLACLLGLILAISLTISGDGSALMKGCNSTNMpvnAR---SPVIVNCPFDATRIYDTTLALWFTCGAFTAVEA 170 zebrafish
Q4RKP6        94 SFLNALLSAACCLGLLVAVGFTVANNGEGLMLGCNDTEApinAR---SPVSARCPFDTTRIYDTALALWIPCTLLSGFEA 170 spotted green p...
XP_005995638 100 SVASTLLSTACVLSLIAVIIMTVSNKGHTLLAACNFTTAe-------VRFAHKCPFDPTRIYDTALTLWIPSAFLAVVES 172 coelacanth
XP_002940070  97 GIINAILSVACVVDLVVSVIITVGNKGRTLLSSCAFTNVe------FIQISYDCPFDPTRIYSTTLCLWVISILLDGAEV 170 tropical clawed...
XP_007669943 198 SLTSALFSVTCALGLLASIAITFANQGQSLLATCSFSSPe------LAQFSPDCPFDPTRIYSSTLCLWGISLVLEVAES 271 platypus
XP_005317826  98 SVACALLSLICALGLLASIAVTFATQGRALLAACTFGSPe------LLALTPDCPFDPTRIYSSSLCLWGISLVFCVAES 171 thirteen-lined ...
XP_001381418  98 SVTSALFSLVCSLGLLASIAITFANQGRSLLATCSFSNSe------PLSLTPDCPFDPTRIYSSTLCLWAISLTLCVAAS 171 gray short-tail...
XP_003228791  97 SVGSTLLSLFCSAGLAVAIVVTFANQGRTLLELCTFANVd------LIQISHECPFDPTRVYSSALALWGLSFLLDSIEI 170 green anole
Q53RY4       179 ALSGYCCVAALTLRGVGPCRKDGLQGQL 206 human
XP_022528700 158 GLSVWCFIIGLTLRGIGPCGHTYLKEQL 185 Mexican tetra
XP_003200362 171 GLSVWCFIVGLQLRGIGPCAQNYIREQL 198 zebrafish
Q4RKP6       171 GLSAWCFLVGLGLRGLVPCARKYIKEQF 198 spotted green pufferfish
XP_005995638 173 VFTVRCFLFSVSLLNLQVLKKKHPRKRV 200 coelacanth
XP_002940070 171 VFSVRCFLAVSKLMDIRFCHKRQDKFri 198 tropical clawed frog
XP_007669943 272 IFSVRCAQLIHQLLELKPWWGKSSTRMH 299 platypus
XP_005317826 172 VFAVRCTQLAHQLLELRPWWGKSSHHMM 199 thirteen-lined ground squirrel
XP_001381418 172 AFAVRAAQLTHQLLELRPWWGKRSHKlv 199 gray short-tailed opossum
XP_003228791 171 IFSVRCFLIVSGLLNLKFCCKGTRKKKV 198 green anole
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap