Conserved Protein Domain Family
RhlB

?
pfam12300: RhlB 
ATP-dependent RNA helicase RhlB
Proteins in this entry are DEAD Box RhlB RNA Helicases found in Xanthomonadaceae bacteria.
Statistics
?
PSSM-Id: 372025
View PSSM: pfam12300
Aligned: 2 rows
Threshold Bit Score: 130.746
Threshold Setting Gi: 502681720
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8P4D4       377 EQKIPVEPVTTELLTPLPRTPRATVEGEEVDDDAGDSVGTIFREAREQRAADEARRGGGRSGpGGasRSGSGGgRRDGAG 456 Xanthomonas cam...
WP_012917350 377 EQKIPVEPVTAELLVALPRTPRVAVEGEAAEAEGDDSIGEIFREARAQREADEQRRGGGKSG-GG--RSGPGG-RGESRG 452 Xanthomonas alb...
Q8P4D4       457 ADGKPRpprRKPRVEGEADpAAAPSETPvvvAAAAETPAVTA------AEGERAPRKRRRRRNGRPVEGAEPVvastPVP 530 Xanthomonas cam...
WP_012917350 453 ADGNPR---RRPRTPRPVD-AAAVTDAP---APAVPKPARVAaegvplVEGERPPRKRRRRRGGRPLDAAEGV----QSG 521 Xanthomonas alb...
Q8P4D4       531 APAAPRKPTQVVAKPVRAAAK 551 Xanthomonas campestris pv. campestris str. ATCC 33913
WP_012917350 522 NVAVSAKPVQVVATPVKAARQ 542 Xanthomonas albilineans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap