Conserved Protein Domain Family
EVC2_like

?
pfam12297: EVC2_like 
Ellis van Creveld protein 2 like protein
This family of proteins is found in eukaryotes. Proteins in this family are typically between 571 and 1310 amino acids in length. There are two conserved sequence motifs: LPA and ELH. EVC2 is implicated in Ellis van Creveld chondrodysplastic dwarfism in humans. Mutations in this protein can give rise to this congenital condition. LIMBIN is a protein which shares around 80% sequence homology with EVC2 and it is implicated in a similar condition in bovine chondrodysplastic dwarfism.
Statistics
?
PSSM-Id: 403497
View PSSM: pfam12297
Aligned: 16 rows
Threshold Bit Score: 452.544
Threshold Setting Gi: 780071645
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_011671659  285 GETAVLSYNARLTQSLVDDNLEtdIQLESQLTWSslpadeetnTHP--GTSFGpitDSICI------TQSitYEESLLYN 356  purple sea ur...
XP_020956646  227 GDSFSVQYTAWLEAGGVGSGEV--LMLPALLSFQ---------TSSpnRTQLK---ALLTI------TTD--EKITVLPN 284  pig
XP_015141279  238 GEYFAINYTALLDAKKTWKGRV--LTLPAQLTFR---------SSSqnQTDLVsltTLFTI------TEE--EKTEVSYS 298  chicken
XP_015200287  212 GSCYTVKYSAQMKGE---QNDI--LSLPAYLTFSn--------ASQndINLFGpvvANFTL------RVN--STAKVSSN 270  spotted gar
Q670Z5        236 GSQVIVNYTAQIRSH---KIEV--LDLPAFLTFSn--------ASQndVSMFGpltTNLTL------RVN--STDRIHPN 294  torafugu
XP_023181035  238 GSHVVVNYTAHVRSH---NNEL--LDLPAFLTFSn--------ASQndVSMFGplrANLTL------RVN--STDRIYPN 296  southern plat...
XP_011473911  234 GSYVAVNYTAFVRSH---KSEI--LQLPAFLTFSn--------ASQndVCMFGplqANLTL------RVN--STDAISPN 292  Japanese medaka
Q8K1G2        147 GECYSVSYTASLDPTALGTGES--LDLPARLIFQ---------SPSqnRTQLK---APFTI------TVE--EKIMVLPN 204  house mouse
XP_028431736  245 GSQVVVNYTAHIKRH---KSEV--LDLPAFLTFSn--------ASQndVSMFGpltANLTLtvnstdR--------IYPN 303  yellow perch
KAE8629120    259 GEYLLIKYNASLSSGLATDGLQ--LSLPAQLSFQn--------SSAvaGTSLRl-mAAFTV------TAK--ENIKVLPN 319  tropical claw...
XP_011671659  357 HGLPALFFFVALI--LALVLVILCCFIYAKMSAGGIYAIVQPEgtIsknQHGLIINPRVGKTGVDMVEEYSsvtANESIV 434  purple sea ur...
XP_020956646  285 HGLHAMGFFVALI--LSLLLTWAVLFFMVRYQCLKGSLLSRHRv-R---HHEDKLEHSQFTSADGVNEDLA---LNEQMI 355  pig
XP_015141279  299 HAIHASGFFIAFF--VSLVLTCAVFFILYRTQLLRWSFYSENQeiQhelSQNHKLEHSQFSSGDLFSEDVI---MNDQII 373  chicken
XP_015200287  271 HGIHFVGFLVGFL--VASILMTLAFLLFSWIGIPQMSCCKRKR--RgglSGDTDPEYAVCNVSETAKEEAA---FEDKIV 343  spotted gar
Q670Z5        295 HSAHFAGFVVGFF--VTIVLLSLGFLAMNLTGSRTRLNLLQQRr----kREDSDPDDADCNIDETIKEEAA---FEDKIV 365  torafugu
XP_023181035  297 HGVHFAGFVAGFF--ITLVLLLLGVLAIKFTSSRERFCLFQRKr----nRCHLDPEYADSSMSETIKDEAA---FEDKMV 367  southern plat...
XP_011473911  293 HRVHFAGFAAGFL--VASALLSVGFLAMNLAGPNAGLRLLQQRr----nRGDSDPEYADCSMREAIKDEAT---FEDNMV 363  Japanese medaka
Q8K1G2        205 HGLHAAGFIAAFL--ISLLLTVAALFFLARGRCLQGGMLSRCRi-Q---HPENKLEPSPFTSANGVSQDLS---LNDQVV 275  house mouse
XP_028431736  304 HGVHFAGFVAGFFvtLV--LLSLGFLAMNLI-GLRTRLNLLQQrr---nRRDSDAEYADCNMSETVKDEAA---FEDKMV 374  yellow perch
KAE8629120    320 HGLHALGFVIGFL--VSFLLTCAVLLVLRYTKRLNCRCLGNLHg----tNCEPKLGKSQSNSPDNVNEDFN---MPDKMI 390  tropical claw...
XP_011671659  435 VVLMQKDKTRKVLDFENLDIMSTITTDMRLEEQRISTMIEMFIMLLGSWSLRDLLPRDFSAKLSKKYQRSAKDAIKKLDD 514  purple sea ur...
XP_020956646  356 DILSSEDPGSMLPALEELEIATLNRADSDLEACRTQISKDIIALLLKNLTSSGHLSPQGARRMDAIFQKQFLWLEKEIQE 435  pig
XP_015141279  374 DILTFEESGNMLQALEDLEVASLTRADADLEAYRMQICKEVIAIMMKNMVLSHSLIPHVEKRMSSIFKKQFLTMEREFQE 453  chicken
XP_015200287  344 DIMILEDPQNMYQALENLDMSTLLRAAASLESFRVQVYKDLVAMLLRNLKMNGGVSALAEKRLNSVLNGQLMGMEGKLKE 423  spotted gar
Q670Z5        366 DTMVLEEPQNMYQSLENLEMSTLLRATNNMEATRIQIYKDVMSSLLGGLLSQGHASMQTQQRLLSVLYGQLLGMEGRLKE 445  torafugu
XP_023181035  368 DVMVLEDPQNMYQALDNLETSSLLQASSNLEATRIQIYKDLMSCLLGGLLSRGQISAQAQQRLLSVVHGQLLGMEGRLKE 447  southern plat...
XP_011473911  364 DVMVLEEPQNMYQALENVEMSTLLRASSNLELIRIQIYKDVMSCLLGGLQSERRTSIRAQERLLSVLHGQLLAMEGRLKE 443  Japanese medaka
Q8K1G2        276 AILTSEEPGSMLQALEELEIATLNQADADLEACRNQISKDIIALLMKNLVSGGHLSPQTERKMAAAFKKQFLLLENEIQE 355  house mouse
XP_028431736  375 DTMVLEDPQNMYQALENLEMSTLLHATNNLEATRIQIYKDVMSSLLGGLRSRGQCSAQAQQRLLSVLHGQMLGMEGRLKE 454  yellow perch
KAE8629120    391 DILAFEEPENMLQALDDSEIVNLTHADAYLEACRIHVCKDIIGISLKNMAATVHLPHYEVKRLTAAMSEQWINLEKQIQE 470  tropical claw...
XP_011671659  515 EYGHESRELIKHLSNENKGKLIMLKKKHDAELRLKAAQARSLSKEDLKEVMDLLKKQQAAGATSLTQLLRLKQDEEQEKL 594  purple sea ur...
XP_020956646  436 EYDRKMVALTAECDLDTRKKTESQYQREMAAMEEAEEVLKRGSERSAAECSSLLRTLHGLEQEHLRRSLALQQEEDFAKA 515  pig
XP_015141279  454 EYERKVVALTAECNLETRKKMEAQRQKERAANEEAEELIRKVNEMPAVEYKSLLDRLHSLEQDHLKRFLLVKQEEYFAKA 533  chicken
XP_015200287  424 EHVARMAALAAECNRETREEMEAEHRRVTVEKAQAEHLFQQADQQVVLELSVLLDKLHKLDQSYLQRCLLVRHEEASAKV 503  spotted gar
Q670Z5        446 ERAARMAALANQCNLESREEMEAEHHRETAEKAQAELLYKQADQQELLRCSVLLEKLHKLRQSRLQAKLLVQHEEASAKV 525  torafugu
XP_023181035  448 ERGARMAALAGQCNLETHEEMEAEHQEQAAEKAEAERLRQHADQQEFLQCSRLLEKLHKQRQSHLRRVLLVQREDASAKV 527  southern plat...
XP_011473911  444 DRGARMAALAGHCNLETREEMEAEHRREAAEKARAERLCQHADQQELLRCSVLLEKLHKLNQSRLQRTLLVRHEEASAKV 523  Japanese medaka
Q8K1G2        356 EYERKMLALTAECDLEMRKKTENQYQREMVAMEEAEEVLKRVSERSAAECSSLLRTLHGLEQEDMQRSLTLDQAEDFAQA 435  house mouse
XP_028431736  455 ERGARMAALAGRCNLETREEMEAEHRREAAEKAQAELLCQHADQQELLHCSVLLEKLHKLSQSQLQRILLVRHEEASGKV 534  yellow perch
KAE8629120    471 EHQRKIVALTAECHLDTRKQVDMQERKQKAVYEEAEEKFRHAGEKSLTEYRLLLDKLHDMERAEMMKLLMYKQEEDFAKA 550  tropical claw...
XP_011671659  595 RKEYATKKRIAMKAVQQEYMDKAILQGKLDEDQARRLLSEHQQDMSTVERLMDEEMSRQRMSLEEKLARRKLLAKATESQ 674  purple sea ur...
XP_020956646  516 HRQLAIFQRSELHSIFFTQIQSAIFKGELKPEAAKMLLQDYSKIQERIEELMDFFQASKRYHLSKRFGHREYLVQSLQSL 595  pig
XP_015141279  534 YRQLAVSRRKELHNIFFTQITNATFKGELKLEIAKSLVEDYSKIQGDIEELMDFLQASKKYHLNRRFAYREYLIKKIQLR 613  chicken
XP_015200287  504 QRQTVVCRRLELHKIFFEELEEATRMKELEKNVANQLLHAYFSSQDQLEEVLDIFLANQRSILEERHAQRQFLAHSLQSL 583  spotted gar
Q670Z5        526 QRQIIEWRRVELHKIFSEELEEATRMGEMERSTAKSLQHEYFDCQDHLEEVLDVVLANQRYVLAERHAQRKFLVHSLHSL 605  torafugu
XP_023181035  528 QREIIEWRRVELHKIFSEELEEATRMGELEKSTAKRLQHEYFTCQDQLEEVLDVVVANQRYVLTERSAQRKFLVHSLHSL 607  southern plat...
XP_011473911  524 QRQIVERRRVELHKIFSEELEEAVRMDELEKSAAKSLLHKYFTCQDELEEVLDVVVANQRYVLSERSAQRRFLVHSLHSL 603  Japanese medaka
Q8K1G2        436 HRQLAVFQRNELHSIVYTQIQSAVSKGELRPEVAKMMLQDYSKTQESVEELMDFFQATKRYHLSKRFGHREYLVQRLQAM 515  house mouse
XP_028431736  535 QRQIIEWRRVELHKIFSEELEEATRMGELERSTAKSLQHDYFACQDQLEEVLDVVLANQRYVLAERHAQRKFLVHSLHSL 614  yellow perch
KAE8629120    551 RRELSVCHRTELLGIFSEQLHDSVAKGNITADAGTAVIENHFKIQEEAEDLLDFIQADKKCRMNRTLAARKNIIYIMQLC 630  tropical claw...
XP_011671659  675 EEHHSALLNTMASQTMTAVSELEQSEQLGQEEAKAYVEKLMKEVKGIKENYEKER 729  purple sea urchin
XP_020956646  596 ETRVQGLLSTASAQLSLLIQKHERAGYLDEDQMEVLLERVQTEVFSIKQKLDNDL 650  pig
XP_015141279  614 DSQASALINAAATQILNLINKMERAGHLHESHLGMLLDRAEAEINSVKQKFNHDL 668  chicken
XP_015200287  584 KTLICEVFTNTSRQMENWFQDLKNERYVTEEQANLLLDKAKKELLHVKQNLDEGL 638  spotted gar
Q670Z5        606 NSLISDTFSITSNNLDNWFCQIRRGSTLPVEKVDQLQDEAQKELVMVRQRLDEAL 660  torafugu
XP_023181035  608 EDLISETFSSASSNLDSWFSHIKSGSAVPSEQLDQLQEKAQKDLVMVRQRLDETL 662  southern platyfish
XP_011473911  604 NGLISDSFSTSSRTLDSWFAHVRRGSLIPAEHIEPLQEKAQKELVMVRQRLDETL 658  Japanese medaka
Q8K1G2        516 ETRVQGLLNTAATQLTSLIHKHERAGYLDEDQMETLLERAQTETFSIKQKLDNDL 570  house mouse
XP_028431736  615 NSLISDSFSSTSGNLDSWFTHIRRGSIVPAEQIDQLQDKAQKELVMVRQRLDEAL 669  yellow perch
KAE8629120    631 DSRSRCLLNTAAAQIASLINKTERAGHMNENQAELLMCRAQAEVSRVKQKMDNVL 685  tropical clawed frog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap