5J5K


Conserved Protein Domain Family
HsbA

?
pfam12296: HsbA 
Click on image for an interactive view with Cn3D
Hydrophobic surface binding protein A
This protein is found in eukaryotes. Proteins in this family are typically between 171 to 275 amino acids in length. Although the HsbA amino acid sequence suggests that HsbA may be hydrophilic, HsbA adsorbed to hydrophobic PBSA (Polybutylene succinate-co-adipate) surfaces in the presence of NaCl or CaCl2. When HsbA was adsorbed on the hydrophobic PBSA surfaces, it promoted PBSA degradation via the CutL1 polyesterase. CutL1 interacts directly with HsbA attached to the hydrophobic QCM electrode surface. These results suggest that when HsbA is adsorbed onto the PBSA surface, it recruits CutL1, and that when CutL1 is accumulated on the PBSA surface, it stimulates PBSA degradation.
Statistics
?
PSSM-Id: 403496
View PSSM: pfam12296
Aligned: 234 rows
Threshold Bit Score: 42.2583
Threshold Setting Gi: 429856350
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5J5K_A         9 AATILSDLSTIKTDINTLTQHFNEftgdllQ---ALAAQAVEQQLESDIDQATADAKATSA-LSAADSTSVTNALLGLKP 84  Aspergillus fum...
XP_007927287  34 iTSLVNDITTLTKSVVDLGDTVGGf----tGiseAGTVATKAQTVQDNLQTAADNAKKAPT-LDNNGALALAVPAQALNE 108 Pseudocercospor...
EME78207      22 AAVIVKDVQAVTNAVKDADTTVTSfsg----nadAENLKSKLDAIYSALSQGATDAKASGD-ISQEDALGLASPVQDLAK 96  Pseudocercospor...
EFY88114      18 gDVLSADVAAIVTSVTALQTQVNNfqg----aaqADALIAASDGVVAAIKKGIADANASPP-LTQEEAFTLVPPLNNLIG 92  Metarhizium acr...
EMF08190      24 IDTIIANVQNITNGSLAVQTAANNl----tTladAIPLNEASTHVQAALNLSISNAQQLPEtLNPADGIKLIPYIQELGN 99  Sphaerulina mus...
XP_007926826 210 IDTIIADINNITNHTLQLNQALQNl----sEpiqALAVNTAGIAVQAAINQSIADAMELSE--VPATAIGIIAPIQALGN 283 Pseudocercospor...
XP_016764459  20 tgdlASNVQAITDATKKVTTAIEGyngd---vqqAAAVESASSDVLAAIKSAQSTVDGMST-IDQSAAITLAIPIKDLSS 95  Sphaerulina mus...
EMF17712      31 ATDIASSIATIQAATQSLNTAVSFg--------dLLALTSANSAVVNAIKAATSEANGLSTpLKFDDATTLSTPIKDLGK 102 Sphaerulina mus...
XP_007920605  31 sqDIAADIKAITSATDGLTAALRNfnd----astALAVNAATGKVSDAIKKGTSDANALSS-ISQADALTLSGPIGDLND 105 Pseudocercospor...
XP_007928707  24 IADVSSAISGLTSKVQAVDKAVQAfngd---aqqAVAIQSAAKDLSDTVDKGTAAAKGLPT-LQQQDALGLASPVQDLSK 99  Pseudocercospor...
5J5K_A        85 DIVTSLDAIVAKKPQVDSAGVGSLVLSDLNALQSKTDALSGALQ 128 Aspergillus fumigatus Af293
XP_007927287 109 AVVSTLDKITAKKDVFASASLTSVVAQLLEKDNQLAGDYSTALF 152 Pseudocercospora fijiensis CIRAD86
EME78207      97 AVQQAVTDLTGMKSAIISAGIAQDVYRKLTESDAAQNDFVSAVL 140 Pseudocercospora fijiensis CIRAD86
EFY88114      93 VVNKTVGALVAKKQIFADSGRGCEVYPQLVKQGADSKAFSDALV 136 Metarhizium acridum CQMa 102
EMF08190     100 ASVGAITTLITKQAFFINNNIAALVLPSLVLQNQTSYQFNDELT 143 Sphaerulina musiva SO2202
XP_007926826 284 ASNLTIASLIFQKPFFVQYGFQNLTLQTMQLQNLTSTQFNEILL 327 Pseudocercospora fijiensis CIRAD86
XP_016764459  96 AVDASITALIGKKDAFDKAGLSSLVLSSLQDQKKASDALTSALL 139 Sphaerulina musiva SO2202
EMF17712     103 VFDSTITKLIGKSSSMIDA--RQTILSGLESQLSASAAFSTALS 144 Sphaerulina musiva SO2202
XP_007920605 106 ATKRSIDQLIAKKPLFVSLGFAGIVLDTLKSQQAQSSAFSEAVI 149 Pseudocercospora fijiensis CIRAD86
XP_007928707 100 AVNQTIGDLIAKKDAFVKAGLGGAVREILEGQQKSASAFVDAIL 143 Pseudocercospora fijiensis CIRAD86
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap