Conserved Protein Domain Family
T4BSS_DotH_IcmK

?
pfam12293: T4BSS_DotH_IcmK 
Putative outer membrane core complex of type IVb secretion
T4BSS_DotH_IcmK is a family of bacterial transporter proteins from Proteobacteria. DotH is an integral outer membrane component and it may form an outer membrane complex along with DotD and DotC functionally equivalent to secretins. DotH is the strongest candidate for the VirB9 counterpart of other T4BSS systems.
Statistics
?
PSSM-Id: 403493
View PSSM: pfam12293
Aligned: 7 rows
Threshold Bit Score: 307.81
Threshold Setting Gi: 383082741
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
NAM:HDEF_p0034  86 PLSGPEIEALSRGADEVRRGRAYQPRT-IVPRISTLTVNLSPGASIPILRTAANQTSSLTFSDSTGAPWTLGAPPLNSnh 164 Candidatus Ha...
WP_014103953   129 PMRPEEIRELLKRYDQTLEAVQTPLQPyPEPEVVVQTVALDPGVRPSEIKVAVGHVTTLNFVDVTGAPWPIEDVSWAG-- 206 Micavibrio ae...
jgi:Bind_3863   53 PLTPEMIRELGRRYREIKREEERATTQiATPVSRRINVAFIPGQATNIIQTVKGYPSAISFFDSTGQPWPIEWNSNSNps 132 Beijerinckia ...
Q5ZYC2         121 PLNPEQVVKLKQIYETSEYAKAATPGTpPKPTATSQFVNLSPGSTPPVIRLSQGFVSSLVFLDSTGAPWPIAAYDLGDp- 199 Legionella pn...
Q83B85         106 PLSPDQIRTLHYLFDQSQQAAAAAPGVpPKPTSASVIVNLSPGATPPIIRLSSGFVTSLVFLDSSGAPWPIQAYDLGDp- 184 Coxiella burn...
BAM06268       142 PLSPGDIGLLKGILKQTQKAVHGPP---PEGRAVSVSVSLDPGAQFPVIHLVPGIASTITVVDASGAPWPIEDVIVGNa- 217 Leptospirillu...
Q877T8         105 PLTPQEIRQLRGQVGEVDKA-MAAPQVaIVPRISAQTVNLSPGASLPLVRTAVNYPTSLTFIDSTGAPWNLGAAPISGn- 182 Pseudomonas s...
NAM:HDEF_p0034 165 ---------------------kGFQVSYIPSSALIA-VQALRRYDTGNITVYLEGLHVPVVIHLTSGSPqsraqtqIMDS 222 Candidatus Ha...
WP_014103953   207 ----------------------DFEILKPGEGGWVLrVTPMQEFAYGNLSVKLLELKTPITFVMNTRRD-------TVHY 257 Micavibrio ae...
jgi:Bind_3863  133 siaggsncnattntggpavaavGFHVCTPTKGSNVLeVTPMSLEPRGGLVVTLEGAPKPLSFMLVGGGG-------RYDS 205 Beijerinckia ...
Q5ZYC2         200 ---------------------sSFNIQWDKTSNTLM-IQATKLYNYGNLAVRLRGLNTPVMLTLIPGQK-------AVDY 250 Legionella pn...
Q83B85         185 ---------------------kSFNIQWNKKDNTLL-VQALSHYKAGNLAVVLEGLDTPVMLTLMPGQR-------AVDY 235 Coxiella burn...
BAM06268       218 ---------------------kSFPVRRMSATNGVV-IEPQNNVGWTSLSLVLRGRGTPAVLKLVDSDT-------LSDT 268 Leptospirillu...
Q877T8         183 ---------------------pDITPYYVPNSPVMV-LYAAKPFASGNVTVYLKGLAVPIMLYVSSGESdtkaqtwAVDA 240 Pseudomonas s...
NAM:HDEF_p0034 223 RLDLRIPQRGPNAK-PSAPPDSQI-ALYNNLLQAFLDGVPPLDAKPLRTRGQVP-STTVWQWGEHLYIRTQSDIRDE-FE 298 Candidatus Ha...
WP_014103953   258 RMDARIPEYGPYAK-PPIIDGGITiAAGNAAQASILDGIIPDSAEKLVVSGVDG-RTTAYRFKGNVYVRTPLTMLSPgWS 335 Micavibrio ae...
jgi:Bind_3863  206 DVSVHVADRGPHAKvEITRRTPAP-DTGSGFLTAMLDGVPPAEATPLVVSGVSPeDLRAWRLGDKVFLRTRMTLISPeWT 284 Beijerinckia ...
Q5ZYC2         251 RVDLRVQGYGPNAK-SMPTEEGIP-PSANDLLLHVLEGVPPPGSRRLVVSGG---DARAWLSNEKMYVRTNLTILSPgWL 325 Legionella pn...
Q83B85         236 RVDLRVPGLGPNAN---PDLDGLP-ATESPELLNVLNGVPPSNSKPLTITGG---DCQGWLIKGHIFLRTRLTVLSPgWI 308 Coxiella burn...
BAM06268       269 RVTARIEARGPNAV-IPIFREAKP-VVSSRVL-AFLDGIPPSEARAIPVHGTG--DMEAWRDGNRLFVRTHLDVLAPaWI 343 Leptospirillu...
Q877T8         241 RLDLRVPRRGPGAQ-PGAAPEVRI-GLHDRVLQGFLDGVPPKEAKQLKTTGNVP-DTTVWQMGDDLYIRTRADIRDE-FE 316 Pseudomonas s...
NAM:HDEF_p0034 299 QTLSSLDGTHLWKLPLTPTVHFSVMGKTEPL 329 Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)
WP_014103953   336 GSVSSADGMNVYTIEDAPVLLLSDKGRMVRA 366 Micavibrio aeruginosavorus
jgi:Bind_3863  285 ASEAGEGGLTIYSVPATPVVLLSGHGRTVSa 315 Beijerinckia indica subsp. indica ATCC 9039
Q5ZYC2         326 ASMTSADGTHAYEMQKSPVLLVSWHGKVMQL 356 Legionella pneumophila subsp. pneumophila str. Philadelphia 1
Q83B85         309 STMSSADGTHAYELQTTPVVLASQRGQLVKL 339 Coxiella burnetii
BAM06268       344 ETVSGPNGMKLYVF--SPVSVITAAGEDGEM 372 Leptospirillum ferrooxidans C2-3
Q877T8         317 STLSSADGTHLWKLPVTPYVSFSVMGHTAAL 347 Pseudomonas syringae pv. tomato
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap