Conserved Protein Domain Family
Chs3p

?
pfam12271: Chs3p 
Chitin synthase III catalytic subunit
This family of proteins is found in eukaryotes. Proteins in this family are typically between 288 and 332 amino acids in length. This family is the catalytic domain of chitin synthase III. Chitin is a major component of fungal cell walls and this enzyme is responsible for its formation.
Statistics
?
PSSM-Id: 403476
View PSSM: pfam12271
Aligned: 95 rows
Threshold Bit Score: 266.688
Threshold Setting Gi: 336375179
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EPS93918       3 QFGDFAPLCHTVp----SYPWCNLFYRQinqhdpallqnssADPaTAPVGvnpqC---GILRvgADGSIGNVANIVVCAV 75  Fomitopsis pini...
EHY54840       5 QFGNFQDFCRDS-----TLPICNILTSYn-----------qPPG-NGYGG----CvlrGITLs-NNRYLANLGSILLCGV 62  Exophiala derma...
EPS27480       5 QFGNFHDFCRDS-----TLPVCNLFKPNq------------PPG-INYGG----CvltGIPLs-GDRHLANLGSIILAFL 61  Penicillium oxa...
EKV13008       5 QFGNFHNFCRDS-----TLPVCNLFTNEt-----------aT---AAFGA----CdltGIPLs-GDRHLRNLGSILLAFI 60  Penicillium dig...
Q4WJ62         5 QFGNFNDFCRDS-----TLPVCNLFVAHn-----------qPPN-EAYDG----CaltGIDLg-NHRYLSNLGSILLAFI 62  Aspergillus fum...
XP_001544327   5 QFGNFLKLCRDS-----ALPVCNLFVADn-----------qPPN-GKFGG----CalrGINLs-GDRNLANLGAILFAVT 62  Histoplasma cap...
EAS37109       5 QFGNFHDFCRDT-----TLPICNILVNNn-----------qPPN-AKFGG----CpltGIGLs-DGRHLSNLGSILLCFI 62  Coccidioides im...
EED15012       5 QFGNFHDFCRDT-----TLPVCNLFVPSn-----------qPPN-VAFGG----CaltGIHLt-NGRYLGNLGSILAAFL 62  Talaromyces sti...
XP_003833844   3 RYGKFDDFCRDTgnigsTLPVCNLFNQAt------------TKRgTGWGG----CdleGFSVg-GGERLRNLGSIILCGI 65  Leptosphaeria m...
XP_007705175   4 SYGEFADFCRDSgnqwsTLPVCYLFNPAs-----------tKINnGWQGG----CtlrGFPVg-GGRNLHNLGSILLCAI 67  Bipolaris sorok...
EPS93918      76 SIIFTLLLVFWTSRRRAAVGRVEMREFLVLYLLTLPFQLVTTGSFlEQGSTALTAVTAIHAGLVAATFWSLLGNAIVSTQ 155 Fomitopsis pini...
EHY54840      63 AILCTLFLLWRAERKAAAVGRREMQLFFLGFLVIEICEIFTVGGF-PLDNDVRKGFTAVHLAAITATTWLLLMNALVGYQ 141 Exophiala derma...
EPS27480      62 AIVVTIALLWRSDRKHAAVGRREMQLFLLGYVVIEICEIFTVGGF-PLAENVRKGFTAVHLAAITATVWILLMNALVGFQ 140 Penicillium oxa...
EKV13008      61 AIVLTVGMIWRSDKKQAAVGRREMQLFLLGFVIIEICEIFTVGGF-PLSDAVRKGFSAVHIAAITATCWVLLMNALVGFQ 139 Penicillium dig...
Q4WJ62        63 SILVSLFLLWRSERKQAAVGRREMQLFLLGFIIIEICEIFTVGGF-PLDSTVLKGFTAVHIAAITATCWILFLNALVGFQ 141 Aspergillus fum...
XP_001544327  63 ALLLSAFLLWKSERKKAAVGRREIQLFLLGYMIIQLCEIFTIGGI-PISDNVRKGFTAIHLGAIAATAWILLLNAIVGFQ 141 Histoplasma cap...
EAS37109      63 AILMTVFLIWKSEKKKAAVGRREIQIFLVGFVIIQICEIFTVGGF-PLDDNVRKGFTAVHLAAISATTWMLFVNALVGYQ 141 Coccidioides im...
EED15012      63 AILACIFLLLLSERKRAAVGRREIQLFLLGYIVISICEIFTVGAF-PLSDDVRKGFSAVHVAAITATTWILFLNALVGFQ 141 Talaromyces sti...
XP_003833844  66 AIVATAFLLWRTQRKKAAVGRREMQLFLLGYILISICEIFTIGGF-PLNDSARLAFTAIHIAAITATSWILMLNGAVGYQ 144 Leptosphaeria m...
XP_007705175  68 ALLVSLFLLWRSQRKKAAVGRREMQVFLIGYMIVSICEIFTIGGF-PLNDKVRIVFVAIHIAAITATSWILMLNGAVGYQ 146 Bipolaris sorok...
EPS93918     156 VVEDGTLSALIPFNFFILAFFAVTTYIALDVGFSFtHAFGPSdplsseSSIPLFVLTSIWPGAAAIIYFVTMVYVVLGML 235 Fomitopsis pini...
EHY54840     142 LIDDGTPLSLGLVGGSALVLFIGTGYIALDTAFSWtGYWDSSlqp-phRNIALYVLYQLAPLVFMFLFFVLESILVLRIL 220 Exophiala derma...
EPS27480     141 LIDDGTPASIGLISASAIALFIGTGYIALDTGFSWtGHFDSSlgdgnnRNIGLYVLYQLFPLVCLVLFFLLETVLVLRVL 220 Penicillium oxa...
EKV13008     140 LLDDGTAASIGLIGASAAAFFIGTGYIALDTGFDWtGRFQSShes-pnRNIALYVLYQLFPLVCLVLFYLLEAVLVLRVL 218 Penicillium dig...
Q4WJ62       142 FLDDGTPVSVGLCVASALVFFIGTGYIALDTAFDWtGEFAMTpsd-hyRNIALYVLYQLFPLVLLVAFFVLESVLVIRVL 220 Aspergillus fum...
XP_001544327 142 LLDDGTPVSVGLLLASGAILFIGTGYIALDTGFRWtGHFDPSlng-enRNIGLYVLYLLFPLICLVTFFALEAVLVLRIL 220 Histoplasma cap...
EAS37109     142 FLDDGTPISIGLLLTSAAVLFIGTGYIALDTAFSWtGYFDPSlsg-enRNIGLYVLYLLFPLICLVGFFVLESILVLRIL 220 Coccidioides im...
EED15012     142 LLDDGTPLSVGLFAGSAIVLFIGTGYIALDTGFSWtGHFDSSlsg-nnRNIGLYVLYLLFPLVCLFFFYILEVILVLRVL 220 Talaromyces sti...
XP_003833844 145 LLDDGTAVSVGLLLISSLIIFVGTGYIALDTGFSWtGYWESTlar-pnQAYALYTLYQLVPLLFIVIFFLLEAFLVLRIL 223 Leptosphaeria m...
XP_007705175 147 LLDDGTAVSIGLLLGSAIAIFIGTGYIALDTGLGWtGYWDSSlna-pnKAYALYTLYQLVPLFFIVVFFLLEAFLVLRVL 225 Bipolaris sorok...
EPS93918     236 NEVRPVWYFVLAMVIFVLSQLDFFLLNKVICKGTSAKVDGSFVATILETAAVGVLYLAWRSITEESWDD 304 Fomitopsis pinicola FP-585...
EHY54840     221 RETKPMVYLIAATLLFAIGQIFEYVISVHICNPTHGKINGALFETLFTLLSVVALFVFWSSITEDDWPM 289 Exophiala dermatitidis NIH...
EPS27480     221 GEVRPMLYLVGAALLFAIGQIFQYVISTHLCQATSGKIDGALFETLFTLLSVVTIWGFWSSITEDDWPL 289 Penicillium oxalicum 114-2
EKV13008     219 GEYRPMLYLTGAGLLFAIGQIFNYVISTHLCQASDGKINGALFETLFTLLSVIGVWAFWSSITEDDWPL 287 Penicillium digitatum PHI26
Q4WJ62       221 GEFRPMLYLSAAGLLFAIGQIFNYVISTHLCQASHGKINGALFETLFTLLSVVMVWIFWSSITEDDWPM 289 Aspergillus fumigatus
XP_001544327 221 GELRPLLYLSAAGLLFAIGQIFQFVISTHLCQASNGKINGSLFATLFTELSVGAIWIFWSSITEDDWPM 289 Histoplasma capsulatum NAm1
EAS37109     221 GEMRPMLYLSGAALLFAFGQIFDFAISTHLCHASDGKINGALFETLFTLLSVGMVWIFWSSITEDDWPM 289 Coccidioides immitis RS
EED15012     221 GERRPLIYLTLAALLFAIGQIFDFVISPHICNPVHGKINGAFFETLFSLFSVVTVWLFWSSITEDDWPA 289 Talaromyces stipitatus ATC...
XP_003833844 224 GERKPMLYLLTAALLFAIGQIFQYVISVHICTGTDGKINGGLFSTLFTLLSIVMIWIFWSSITEDDWPM 292 Leptosphaeria maculans JN3
XP_007705175 226 GERKPMLYLIAAALLFAIAQIFQYVISVHICNGSDGKINGGLFETLFTLLAVVMVWVFWSSITEDDWPM 294 Bipolaris sorokiniana ND90Pr
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap