Conserved Protein Domain Family
DUF3612

?
pfam12268: DUF3612 
Protein of unknown function (DUF3612)
This domain family is found in bacteria, and is approximately 180 amino acids in length. The family is found in association with pfam01381.
Statistics
?
PSSM-Id: 372003
View PSSM: pfam12268
Aligned: 9 rows
Threshold Bit Score: 380.297
Threshold Setting Gi: 500092714
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_013052193    328 TVVSPYPHWHYFDAYAPGKLKAVYRGNGIPLPWGNMRLVQDPCQHWAVFRKINEDSSGSSAQLSILDVDNEPRIYSCESI 407 Shewanella v...
jgi:Shew_2560   330 TAVSPYSHWHYFDAYSPGKLKAVYRGNGIPLPWGNMRQVEDPCQHWAVFRMINASTQGSSAQISILDVANEPKIYCCESI 409 Shewanella l...
SDU:GNIT_3513   306 TAVSSYRHWHYFDAYAPGKLKAVYRGNGIPLPWGNMREVEDPCQHWAVFRMINAPVAGSSAQISILNVGDEPRIYCCEST 385 Glaciecola n...
jgi:Sama_0680   326 TVVSPYPHWHYFDAYAPGKLKAVYRGNGIPLPWGNMRQVPDPCQHWAVFRMISEPSDGSSAQISILDVGGSPRIYCCEST 405 Shewanella a...
WP_011768727    330 TAVSAYPNWHYFDAYSPGQLKAVYRGNGIPLPWGNMRVVKDPCQHWSVFRMLGMNAKGTAAQISILNENGAPKIYCCESI 409 Psychromonas...
tigr:TERTU_0338 331 TAVSPYPHWHYFDAYPPGKLKAVYRGNGIPLPWGNMRSVKDPCQHWSVFRMINTPVKGTASQLSILNVNGSPRIYCCESK 410 Teredinibact...
Q5E0W8          326 TVVSPYPHWHYFDAYAPGKLKAVYRGNGIPLPWGNMKQVSDPCQHWAVFRRLTEPKEGSSAQISILNVGSEPRIYCCESI 405 Aliivibrio f...
Q87JP8          327 TVVSPYPHWHYFDAYGPGKLKAVYRGNGIPLPWGNMRKVNDPCQHWAVFRRLSQPLDTSSAQISILNVGDEPRIYCCESV 406 Vibrio parah...
Q8E8F9          319 TVVSPYPHWHYFDAYAPGKLKAVYRGNGIPLPWGNMRLVEDPCQHWAVFRMISEPSVGTSAQISILNVGNEPRIYCCESI 398 Shewanella o...
WP_013052193    408 RVKDMAGNNHVLCAGIDLNPAIQAQGGDASGIAAELKQACVKHGGEAEIPKAIKKDLTSVAKILNINWVERGIETQARLI 487 Shewanella v...
jgi:Shew_2560   410 RVKDLAGNPHVLCAGIDLNPAIEAQGGDANQVAQQLKEVCVDNGGSAPLPSNIKTDIKRVAKILNINWVERGIDSEARLI 489 Shewanella l...
SDU:GNIT_3513   386 NVKDMADNNHVLCTGIDLNPAIDAQGGDSASIAEDLKQACVKGGGSSAIPNSIKSQLSSVARILNINWVERGIETDARLI 465 Glaciecola n...
jgi:Sama_0680   406 KVVDLAGNHHVLCAGIDLNPAIDAQGTDALSLAEALKSHCVASGGQGEIPTAIKRQLMSIARILNINWVERGIDKGARLI 485 Shewanella a...
WP_011768727    410 KVQDSADVNHVLCAGIDLNPAIDAQGHDALALVRELKQICIANGGSATIPAHIKKVLISVARILNINWIERGIAGEARLI 489 Psychromonas...
tigr:TERTU_0338 411 YVEDLAGQNHVLCAGIDLNPAIEAQGKDAHTLAQELKAICVSNGGSAPVPAAIKRDLTTVARILNIAWVSRGIEGDARLI 490 Teredinibact...
Q5E0W8          406 NMTDPAGNNRVLCAGVDLNPAIEAQGKDAVALARDLQKACVKNGGESSISKSIKRELISVAKILNINWIERGVESDAKVI 485 Aliivibrio f...
Q87JP8          407 NVFDPAGNNRVLCAGIDLNPAISAQGGDAVSIAEELKSLCVASGGSSVIPPHIKKDLTTIAKILNINWIERGIQSQARLI 486 Vibrio parah...
Q8E8F9          399 KVEDSAGNPHVLCAGIDLNPAIEAQGKDALSIAHDLKAACVTGGGSVAIPKHIKSDLVSIAKILNINWIERGIKNDARLI 478 Shewanella o...
WP_013052193    488 CARGAVCPRQPTCYEA 503 Shewanella violacea
jgi:Shew_2560   490 CSRGASCPRKPSCYES 505 Shewanella loihica PV-4
SDU:GNIT_3513   466 CARGAVCPRKPSCYSK 481 Glaciecola nitratireducens FR1064
jgi:Sama_0680   486 CSRGNVCPRKPSCYGG 501 Shewanella amazonensis SB2B
WP_011768727    490 CSRGAVCPRQPSCYMD 505 Psychromonas ingrahamii
tigr:TERTU_0338 491 CPRGTECPRVPSCYDG 506 Teredinibacter turnerae T7901
Q5E0W8          486 CSRGAVCPRKPTCYK- 500 Aliivibrio fischeri ES114
Q87JP8          487 CSRGAVCPRQPSCYSK 502 Vibrio parahaemolyticus
Q8E8F9          479 CSRGAVCPRQPSCYQA 494 Shewanella oneidensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap