Conserved Protein Domain Family
DUF3611

?
pfam12263: DUF3611 
Protein of unknown function (DUF3611)
This family of proteins is found in bacteria and eukaryotes. Proteins in this family are typically between 180 and 205 amino acids in length. There are two completely conserved residues (W and G) that may be functionally important.
Statistics
?
PSSM-Id: 403472
View PSSM: pfam12263
Aligned: 76 rows
Threshold Bit Score: 119.607
Threshold Setting Gi: 300261553
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Cyan7425_4278  11 APQTKGMSRNLRLFNWLSFWLQLALGAAAILTLVFAITGRRftqgyepiapglgltplAQ--GTTPGIGIGIFWAVCALI 88  Cyanothece...
CCJ05783          183 alvghDLGRRIRLMGWIGFWLDFILAFLTAPLLAFGAVGQSi--------------------SSTVWVSDPIHWGYFGLG 242 Methylocys...
Q3JAE2            189 SKAILRLVRNLRLLGWTAFWIQFGLAIASALLLLFTTSGQSl--------------------SPN-QLSSGLTWAVYDFI 247 Nitrosococ...
jgi:Nhal_2078     196 AKAILRLVKNLRRLGWTVFWIQFIFAIASALLLLFATSGQVl--------------------SPN-ELSGGLLWAFYAFV 254 Nitrosococ...
WP_015119933        9 SPSKQEFAGVFRLFGRISFWAHLLLGVAAGILLLLVMFSRNf----------------SE--INSAFIGFGIFLAVCGVI 70  Rivularia ...
jgi:Sta7437_1600   11 lPPKQKFASTFGFLGQVSYWVHLLLGFASGITLLLVFFSRSf----------------SEq-SNNPAIATVLFFSLAAIL 73  Stanieria ...
jgi:Glo7428_4098   11 apTKQRFAATFRVVRRVSFWVQLGLGTVSSLALLLAIFSRNt----------------TVqaTTNPVMAFGVFLGITGIL 74  Gloeocapsa...
jgi:Npun_F3085     11 pPSKQKFAATFRLVSRISFWVQLVLGGISGIAVLLACFSRNi----------------TTq-TSNAGIGFSIFLAIVGIL 73  Nostoc pun...
WP_015152574       11 tpTKQRFAAAFRIVSRFSFWIQLALASTSGIALIFAILSRNa----------------SEv-AENASISLSIFLAIVGVL 73  blue-green...
WP_015155804       11 tpTKQRFAATFRVVSRFSFWIQLALASTSGIALTFAVFSRSl----------------SVa-TENAAIGLSIFLAVVGVL 73  blue-green...
jgi:Cyan7425_4278  89 VLLFNLYLAFRLTRLGKRL-RHPNPALRPQLFQVRQILKLGVVMGLVGVLLALLGEGTTLGVLLAKSVAQpqGVAIYDPS 167 Cyanothece...
CCJ05783          243 LLFASLFLDLFSTIASGRLmRDPASMLAADQPAALWFLGASSLVNVLGSVVSFIGVGLSIALLVAKTVSQppGIAITDPD 322 Methylocys...
Q3JAE2            248 ILCLTTLFFFYYTRLAKKItLKPNFYINPEKKSSPWFLRLSYKTSLLGMLVSFIGIGTSLYLLIAKTVSQppGIAITDPS 327 Nitrosococ...
jgi:Nhal_2078     255 ILCLSTIIFFYYTRLARKIyLEPDTYISAEKESSPWLLGLSSKVSLLGTLVSFIGMGVSISLLIAKTVSQppGIAITDPS 334 Nitrosococ...
WP_015119933       71 AVGFRVFWAYRYTRLAKRL-QLPDSNLHPKKEEVIKILRIGLVTSLLGIGLGFLASEGAVIAVLGKTLAQpqGVAVYNPE 149 Rivularia ...
jgi:Sta7437_1600   74 VLGFRMYWAWRCTRLAQSL-QAENPRLHPKRKEIINVLRVGLLVSMLGLLLGFIATEVTVVAVLAKAIAQpqGVAVYQPE 152 Stanieria ...
jgi:Glo7428_4098   75 VLCFRLYLSFRYRRLDRTL-QSPNRELHPKKEEVLQLLNTGLIVSLIGLLLAFLASEVTIATVAAKALALpqGVAAYTSI 153 Gloeocapsa...
jgi:Npun_F3085     74 LLCFRVYWAFRYRKLAKTL-QTPNTQNHPRKEDVIQNLRIGLLASFVGLLIAFIASETTVAIILGKAVAQpqGVAIYQPE 152 Nostoc pun...
WP_015152574       74 LAAFSVVWAFRDRSLARRL-QSSDRTIHPRKEEVIQALKIGLIVSFIGMLIAFVASEVSAIAVLSKSLSVpqGVAIYNRQ 152 blue-green...
WP_015155804       74 LAVFRIFWAFRGRVLARRL-QSPERELHPRKEEVIQVLKIGLIASFIGMLLAFIASEVSAISILSQALAVpqGVAVYQQG 152 blue-green...
jgi:Cyan7425_4278 168 RIIRSLDIFVAIANMNGLTANFIATVTPLGLLNSL 202 Cyanothece sp. PCC 7425
CCJ05783          323 RIVRALDVFILMANFNLLLAHFIGAGAAVWLsmqa 357 Methylocystis sp. SC2
Q3JAE2            328 KIVRALDVFILLINFGLLIAHFIGAVISIWVtvla 362 Nitrosococcus oceani ATCC 19707
jgi:Nhal_2078     335 KIIRALDVFILVINFSLLTAHSIGTMVSIWVtila 369 Nitrosococcus halophilus Nc 4
WP_015119933      150 TVVRSIDLLLILADVTIIGAHFLGAVNSLGLVEWL 184 Rivularia sp. PCC 7116
jgi:Sta7437_1600  153 KIVRSMDLFLILANVNIMGAHFLGGMNSLGLLDWI 187 Stanieria cyanosphaera PCC 7437
jgi:Glo7428_4098  154 NSIRPLDIFVVLANVNLIGAHFVGSVIALGLFSWL 188 Gloeocapsa sp. PCC 7428
jgi:Npun_F3085    153 NVIRSLDIFVMLANVNMIGAHFFGGVTSLGLLYWL 187 Nostoc punctiforme PCC 73102
WP_015152574      153 NLIRSLDILVILSNVNLIGTHLIGSITSLGLLEWI 187 blue-green algae
WP_015155804      153 NVIRSLDILVILANVNLIGTHLVGSLSSLGLLEWI 187 blue-green algae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap