Conserved Protein Domain Family
DUF3604

?
pfam12228: DUF3604 
Protein of unknown function (DUF3604)
This family of proteins is found in bacteria. Proteins in this family are typically between 621 and 693 amino acids in length.
Statistics
?
PSSM-Id: 371976
View PSSM: pfam12228
Aligned: 33 rows
Threshold Bit Score: 717.884
Threshold Setting Gi: 119713159
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ABL97718      60 NPNRDAFFGDLHVHTMYSFDAFIFGTTASPDDAYRYAKGGSI---KHP-LG---FDMQLDDPLDFYAITDHAAWLGMIRA 132 uncultured mari...
WP_007225621  77 NADRQAFFGDLHVHTTYSLDAFAFGTVATPSDAYRYAKGDAI---RHP-GG---FDVQLRDPLDFYAVTDHAGFLGLMKE 149 marine gamma pr...
EAW41461      59 SAERNAYFGDLHVHTGYSFDAYAFGTVATPYDAYRYAKGEPL---AHP-SG---YEMQLRQPLDFYAVTDHAMFMGLLKE 131 marine gamma pr...
WP_007233865  68 NPDRNAYFGDLHVHTTLSFDASAFGTTATPADAYRYAQGEAI---LHP-GG---FEVQLAQPLDFYAVTDHAIMLGLVNE 140 marine gamma pr...
EAW31352      64 NADRNAYFGDLHVHTTLSFDASAFGTTASPADAYRYAQGEAI---KHP-GG---FEVQLAQPLDFYAVTDHGVLLGLINQ 136 marine gamma pr...
WP_007235915  64 NPDRNAFFGDLHVHTALSFDASAFGTTASPSDAYRYAQGEAI---AHP-SG---FEVQLTQPLDFYAVTDHGVLLGLINE 136 marine gamma pr...
WP_007233868  85 TGEANLYWGELHLHTTESFDASMMGNKLSIEDAYRFAKGDPL---VGP-GG---ETMQLSRPLDFVAITDHAEGFGTRTH 157 marine gamma pr...
EAW31349      67 NPDMNLYWGELHLHTNESFDATLFGNTLSIDDAYRFARGEPL---SSP-SG---EVMQLTRPLDFVAITDHAEGFGTRTH 139 marine gamma pr...
EAW39871      67 DPNKNLYWGELHIHTRESFDATLFGNTLSIEDAYRFAMGETL---KTA-GG---EAMQLSRPLDFVAITDHAEGFGTRTH 139 marine gamma pr...
ABL97228      37 VQNRIPLFGDLHIHTTLSLDANTQGTLNTPDDAYRYAKGQSLylqPYEaDGtssRSSKLNQPLDFAAVTDHAELLGEVRM 116 uncultured mari...
ABL97718     133 YADPDS----KPGQLDFASDLHGLN-----------DPENLNTNTFVRRAGLFANLLTGELVkpsrnplkilgaylqeDT 197 uncultured mari...
WP_007225621 150 AANPAT----PFSKLPYVEYLHNLN-----------APENVNMGTLATRYKIFTTFIGETLSgieeg-------rinvDM 207 marine gamma pr...
EAW41461     132 AADTTT----AFSKTKAAQPIHNIN-----------APDNYGSYSFFGRQTAFATFLPDVVGelvag-------nldeAE 189 marine gamma pr...
WP_007233865 141 AADTST----EFSQYELSESYHNIN-----------DSVDGGLFDMAKRNLIFNHFFSDVVAnlldg-------tfdnAT 198 marine gamma pr...
EAW31352     137 AADTST----PVSQYDFAQPYNNIN-----------DSVDGGLLDLAKRSKVFSNFVSDVVAnlldg-------tidsAV 194 marine gamma pr...
WP_007235915 137 AIDTNS----AFSQYELAKPYHNIN-----------DSIDGGLLDLAKRSKAFYNFVSDVVAnlldg-------tideNS 194 marine gamma pr...
WP_007233868 158 CSEPNLslreRATCWLMGMDNPALFsifvdgargtaEAGDPSHPAGVYQAKLRQPLDISQMPtckgg-------kdaaQR 230 marine gamma pr...
EAW31349     140 CDDPNLslgeRGACWLANEPNPKIFqilagrargtaELGDPSKPAGVYQQTSRQAPKAGLFPtcrfg-------enapER 212 marine gamma pr...
EAW39871     140 CQETGLslseRAACWLANEPNPMIFrllvdrvrgaeIIGDPSKPAGVYQQTQRTSPKPGSFPtcrfg-------hgslER 212 marine gamma pr...
ABL97228     117 CLDDRS------------SKFNSLQ-----------CKTFRNFPKLSYFYMNAKASMRKPLGfcges-------refcLD 166 uncultured mari...
ABL97718     198 IYgtgayhrethQSAWRDVAQAAERHNDPG---EFTTFIAYEFTSSGPgQSNLHRNVIFKDSRAP---IQPFSIVDSRNP 271 uncultured mari...
WP_007225621 208 ISdi-------sKNAWSDTVDAAEQHNIPG---QFTTFVAYEYTATSAdSGNLHRNVIFRGADKLp--VIPFSTFQDNNP 275 marine gamma pr...
EAW41461     190 VEav-------tRSAWADSINAADQYNQPG---KFTTFAAYEYTSSTDeMGNLHRNVIFQGTDRLp--EVPFSRFHSQNP 257 marine gamma pr...
WP_007233865 199 VNkv-------sKSAWIETVEAANAAYQPG---QFTTFAAYEYTSSSGdKQNLHRNVIFRGSDSLp--AVPFSRLNSINP 266 marine gamma pr...
EAW31352     195 VNda-------sNAAWIQTVEAADEAYKPG---TFTTFAGYEFTSSTEeREALHRNVIFRGTARLp--AVPFSRFNSMNP 262 marine gamma pr...
WP_007235915 195 INsa-------sKSAWQQTIEATNAAYKPG---VFTTFAAYEFTSSTQaREALHRNVIFRSTQRLp--AQPFSRFNSINP 262 marine gamma pr...
WP_007233868 231 CYdn-------tYRDWARYVRLADDYYEPG---ELTTLIAYEFSPGLPdQGKHHRNVIYRSNIVPeraISSFDV---PNA 297 marine gamma pr...
EAW31349     213 CYen-------aSNDWNRYVDLADRYNEPG---KLTTLIGYEYSPGMPeQGKHHRNVIFRSNTVPkraLSSLDV---PNA 279 marine gamma pr...
EAW39871     213 CQrn-------aKTDWAKYIELANQYNVPG---ELTTLIGYEFSPGLPaQGKHHRNIIFRTETVPeraISSLDV---PNA 279 marine gamma pr...
ABL97228     167 AA----------QAPWQETIKAAEKHYDRTsncKFTSFVGYEWTGAVYsGNNLHRNIIFNNSNVP---IEPVSFYEAPTR 233 uncultured mari...
ABL97718     272 EDLWDWMDNLRDL--GIESLAIPHNSNGSNGQMFKLVDWAGNPMDDNYASKRMRNEPLVEITQVKGTSDTHPLLSPNDQW 349 uncultured mari...
WP_007225621 276 ESLWDWMDDLRDQ--GVESLAIPHNSNGSNGQMFKLVDWAGNPMDENYTRKRLRNEPLVEITQVKGTSETHPLLSDNDEW 353 marine gamma pr...
EAW41461     258 EGLWNWMDDLREQ--GVESLAIPHNSNGSNGAMFALADWAGDPMDDDYANQRLRNEPLVEITQVKGTSETHPLLSETDEW 335 marine gamma pr...
WP_007233865 267 EGLWDWMDNLRDQ--GIESLAIPHNSNGSNGAMFAFTDWSGNNIDQEYADQRMRNEPLVEITQVKGTSDTHPLLSKNDEW 344 marine gamma pr...
EAW31352     263 EGLWDWMDGLRQQ--NIESLAIPHNSNGSNGAMFMFTDWAGNAIDQEYADQRLRNEPLVEITQVKGTSDTHPLLSKNDEW 340 marine gamma pr...
WP_007235915 263 EGLWDWMDQLRQQ--DVESLAIPHNSNGSNGAMFAFTDWAGRPIDVDYAAKRLRNEPLVEITQVKGTSETHPLLSQNDEW 340 marine gamma pr...
WP_007233868 298 IELWKGLEATCDKadGCDFLTIPHNPNKAWGLTYSRYTWDGQQYGEDDWRLRQKREPLTEIFQIKGSQECALGVGATDEE 377 marine gamma pr...
EAW31349     280 IELWRGLEATCFD--DCDFLTMPHNPNKAWGLTYSRFTWDGQQYGEADWRLRQRREPLVEIFQIKGAQECALGVGATDEE 357 marine gamma pr...
EAW39871     280 ITLWQGLEATCSG--DCDFLTMPHNPNKAWGLTYSPYTWDGQAYTKNDWRLRQKYEPQVEIFQVKGAQECALGVGATDEE 357 marine gamma pr...
ABL97228     234 KELWNLLDQTCSE--NCAYVVIPHNSNLSNGYMFE-------ESDQDEILIQSTKEPLVEIFQHKGSSECN--IDSNDPL 302 uncultured mari...
ABL97718     350 ADFGI------MNNRVASPFYSSPTGSYVRNAYLRGLSLDSEFKINPYKFGLVGASDTHTGAVSD-KESDYHSKIGildg 422 uncultured mari...
WP_007225621 354 AGFEI------MPYRVATRLPSEPVGSYAREALLSGLAFEDTGISNPYKFGFIGASDTHTGAVSD-DESNYFAKVGllda 426 marine gamma pr...
EAW41461     336 ASFEL------MPFRVATTLASTAPGSYVRDGLLRGMAMADAGTANPYKFGFVGASDTHTGAISD-DEANFYSKVGlldg 408 marine gamma pr...
WP_007233865 345 ANFGI------SPLRVASTLPSEPKGSYVRNAWQRGLAMAEANNANPYQFGVIGSSDTHTAAAAL-EEDNYFGKIGslda 417 marine gamma pr...
EAW31352     341 ADFEI------FPLRTSTRINSDPPGSYVRNAWQRGLSMEEKDGANPYKFGAIGSSDTHTGAASL-QEDNYFGKIGsfds 413 marine gamma pr...
WP_007235915 341 ANFEI------FPLRTSTRLPSNPQGSYVRNAWQRGLSLTTRDSGNPYKFGVIGSSDTHTGAASL-EENNYFGKIGafds 413 marine gamma pr...
WP_007233868 378 CAFAQv----mDPCQPGETTGCAFQTGFVRQGMKVGLELEMEFGFNPLQNGFVAATDSHNSNPGDvEEWDYRGSA----- 448 marine gamma pr...
EAW31349     358 CAFEQv----fDPCQPGEITGCAFETGFVRQGLKVGLELEQELGFNPLQVGFIAATDSHNSNPGDvEEWDFPGAV----- 428 marine gamma pr...
EAW39871     358 CAFEQv----lDPCQPGETTGCAFKTGFVRQGLKVGLELEQSLGFNPLQTGFIAATDSHNSNPGDvEEWDFPGAV----- 428 marine gamma pr...
ABL97228     303 CNFEQlpykdfRSKFQNDLSPS-PDSSFVREALGKGLLSQDKQSINPLKFGIIASTDTHLGTPGAvDENSFSGHGGagk- 380 uncultured mari...
ABL97718     423 tpelrGAAPLtkAFKEQIEESGsnviirgytevgdqeyID-TGYTEwGASGLAAVWAENNTRESIYDAFRRKETFATTGS 501 uncultured mari...
WP_007225621 427 tgvlrGSVSLpeDQVELIKASGrsaikt----vdgkeySVtASETY-GASGLTGVWAEENTREAIYDALRRKETFATSGP 501 marine gamma pr...
EAW41461     409 tpemrGSVPAsfLMRTIIKYNApdllte----vdgkdyLTlSTFATwGASGVAGVWAEENTREAIYDAFRRKETFATSGP 484 marine gamma pr...
WP_007233865 418 tpekrGSVPAsfLYGTLIKLAApemide----vdgetyLNfQNYKYwGASGIAGVWAENNTREAIYDALRRKETFATSGT 493 marine gamma pr...
EAW31352     414 taekrGSIPAsfLYGTLVKLTAnemvee----vdgnnyLDfSGYKYwGASGIAGVWAEENTREAIYDALRRKETFATSGT 489 marine gamma pr...
WP_007235915 414 tpekrGSIPAsfLYGTLVKLAAsemvee----vdgqryLDfSGYKYwGASGIAGVWAEANTREAIYDALRRKETFATSGT 489 marine gamma pr...
WP_007233868 449 -----GTVQSpaLRRVRHTNKGe--------------kAYkSSLKFnTSGGLAAVWAPENTREAIFDALARRETYATSGP 509 marine gamma pr...
EAW31349     429 -----GAVTSsaFRRLREDRSPe---------------AYkSLVKFqTSGGLAAVWAPENTREAIFDALARRETYATSGP 488 marine gamma pr...
EAW39871     429 -----GAVTSsaTRRLRYNSESa---------------DYqSTLKFhTSGGLAAVWAPENTREAVFDALVRRETYATSGP 488 marine gamma pr...
ABL97228     381 --sfrSSIPAglPDDIEF-----------------------------NPGGLAVAWAEENSRSAIFDAFQRKEVYGTSGP 429 uncultured mari...
ABL97718     502 RIKVRFFGGYQIDEA-FDKEDPVNFAYANAVTMGGDIL-----QL--ENQ-TPQFLVWALRD-V-KRAPLDRVQIIKGWT 570 uncultured mari...
WP_007225621 502 RIRIRFFGGYDFSDTmLTNDDGIARAYKDGVSMGSDLL-----AA--DSA-IPSFLLWAVRD-A-KSTNLQRLQIVKGWT 571 marine gamma pr...
EAW41461     485 RMKVRFFGGYDFDATlIDDPEMAKKAYAQGVSMGSDLL-----AS--GDS-APQFLVWAVSD-AvGGVPLQRAQVIKGYV 555 marine gamma pr...
WP_007233865 494 RMKVRFFAGYDLANVqLDSHELIGTAYKNGATMGSTLQ-----AS--NDR-APTFLTWAVAD-P-NTANLQRVQIIKGWL 563 marine gamma pr...
EAW31352     490 RIKVRFFASYAFNNApLNNPELVRDAYQNGTTMGSTLQ-----A---DGNhQPTFLTWAVAD-P-NTAQLQRIQIIKGWL 559 marine gamma pr...
WP_007235915 490 RIKLRFFSGYDFAEDqLSETDLIKEAYRSGATMGATLQ-----A---QGKrQPSFLTWAIAD-P-NTAPLQRLQIVKGWL 559 marine gamma pr...
WP_007233868 510 RIAVRFYAGRDIDQAmIDAPGLVQHLEAAAVPMGSVLS-----TGqqSG--SPEFLVWAIRD-P-MDAPLQRIQMVKGWI 580 marine gamma pr...
EAW31349     489 RLAMRFYAGWGINLAtADDQKTLESLQEDGVPMGGVLR-----PNpsKLD-SPGFLVWATQD-P-IDAPLQRVQMIKGWI 560 marine gamma pr...
EAW39871     489 RIALRFYAGWNIDPSvTSDPNAIESLSDNAVPMGGVLKipaseATnqKNA-SPQFYVWATQD-A-MDAPLQRLQIIKGWI 565 marine gamma pr...
ABL97228     430 RFIVRFFVGDNLDKNmCNNPDNISYAYANATPMGGTIT-----S---DSLaQPSIFISASADsSiKNQFIEKLQVIKGVV 501 uncultured mari...
ABL97718     571 EMSGKPHEEIYDVACSDGRKPSLKTNLCKESKASVNLDNCQISSNSGANELKAVWEDPNFNPDLKAFYYVRVLENPTCRW 650 uncultured mari...
WP_007225621 572 V-NGEHNEQVYDVACSDGMTVDPLTHRCPDNSAEVDLRDCSVTADVGAAELKTVWKDPDFDASNRAFYYLRVLENPSCRW 650 marine gamma pr...
EAW41461     556 K-DGEHAEQVYDVACSDGLSVDPTTHRCPDNGARVNLADCSITPNVGAAELKTVWQDPDFEPGQEAFYYVRVLENPTCRW 634 marine gamma pr...
WP_007233865 564 E-NGEHQEQVFDVACSDGLSVDPQTHRCPDNGAQVNLDDCSRTANVGASELKTLWQDPDFTAGQEAFYYVRVLENPVCRW 642 marine gamma pr...
EAW31352     560 K-NGQHQEQVYDVACSDGLTVDPQTHRCPDNGAQVDLADCSTTANVGAGELKTLWQDPNFIAGQEAFYYVRVLENPVCRW 638 marine gamma pr...
WP_007235915 560 T-NGEHQEKVYDVACSNNLQVNQETHRCPDNNARVDLGDCSTTANVGAAELKVLWQDPDFVPEQEAFYYARALENPVCRW 638 marine gamma pr...
WP_007233868 581 DDAGQTHEKVVDIACSDGLQVDPATGRCLDNGASVDLASCQFSTGSGATELKTLWRDPDYAPDQSAFYYVRVLMNPTCRW 660 marine gamma pr...
EAW31349     561 DNAGNTQEKVVDIACGDNLIIDPATGRCPDNGASVDLETCRFSQNVGANELKTVWHDPDYNPNQAAFYYARVLMNPTCRW 640 marine gamma pr...
EAW39871     566 DKQGKTHERVVDIACADGASVDPSNQRCPDNNASVDLNNCSFSIDSGASELKTLWQDPHYNPEQSAFYYVRALMNPTCRW 645 marine gamma pr...
ABL97228     502 R-NGELLTSVHDVSV-------------TENQSKLDISNCEVTGS-GEKTMCSVWNDPNFNSSENAYYYVRVVANKSCRW 566 uncultured mari...
ABL97718     651 STWDALKSGE--KPREDL--PSTIQERAWSSPIWYVP 683 uncultured marine bacterium EB0_39H12
WP_007225621 651 SSWDAIRAGE--TPRTDI--PATIQERAWSSPIWYEP 683 marine gamma proteobacterium HTCC2143
EAW41461     635 STWDALRAGV--EPRSDL--AMTLQERVWSSPIWYKN 667 marine gamma proteobacterium HTCC2080
WP_007233865 643 STWDAIRAGE--KPRSDL--PATIQERAWSSPIWYSA 675 marine gamma proteobacterium HTCC2080
EAW31352     639 STWDALRAGK--APRSDL--PVTIQERAWSSPIWYSA 671 marine gamma proteobacterium HTCC2143
WP_007235915 639 STWDAIRSGK--LPRGDL--PATIQERAWSSPIWYSA 671 marine gamma proteobacterium HTCC2080
WP_007233868 661 SSFDAIRLGR--EPDPSV--PATIQERAWSSPIWSGG 693 marine gamma proteobacterium HTCC2080
EAW31349     641 SSYDAIRLGR--EPDPRA--PATIRERAWSSPIWLDP 673 marine gamma proteobacterium HTCC2143
EAW39871     646 STYDAIRLNQ--PPSPHV--PSTIQERAWSSPIWISS 678 marine gamma proteobacterium HTCC2080
ABL97228     567 SHNLCLQNPEycEADSDSsiPKVIQERAWTSPVWLET 603 uncultured marine bacterium EB0_49D07
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap