Conserved Protein Domain Family
PNGaseA

?
pfam12222: PNGaseA 
Peptide N-acetyl-beta-D-glucosaminyl asparaginase amidase A
This family of proteins is found in bacteria, archaea and eukaryotes. Proteins in this family are typically between 558 and 775 amino acids in length. There is a conserved TGG sequence motif. PNGase A is a protein which cleaves glycopeptides.
Statistics
?
PSSM-Id: 403439
View PSSM: pfam12222
Aligned: 21 rows
Threshold Bit Score: 451.415
Threshold Setting Gi: 695072512
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ERT01665     120 PVLTPDGPATerssg----------pssasGAVTVTLMEHVFGNSYNAPFVGSYV-PP-AT----PFNRVVMNFTATSAG 183 Sporothrix sche...
EDN94889     199 PVLIPPGVTDetasyngvedtaiiastndaTSCKVVLMEHTFGYSYGIPFVGNYT-PP-GC----KFNRVVMNFTVTSSG 272 Sclerotinia scl...
EGZ74538     187 PIPAGSTQE----------------------ACTVLLMRHDFAFSYGVPYIGDYT-PP-SC----KFNRIVMNFTVVSEG 238 Neurospora tetr...
Q0UTT9        59 PILSPSG------------------------GCQQTLMVYTFALSYGQPFVGDYA-PP-EC----DFNRVAIEFTVTSAG 108 Parastagonospor...
XP_006685489 140 PDVVNPSYGK--------------------SLQHELLFNHTFGNSYGSPFVTTYT-PPsGI----EFNRVVLTLDTYVSG 194 Yamadazyma tenu...
EDK36913     153 PFVPPKWYGS--------------------PVYESLLLNHTFGNSWGNPAETKFV-PPsNV----SFDKVVLTLRTTSSG 207 Meyerozyma guil...
XP_002494029 109 P---SPNFGVp-------------------VFESVLLDSYEFGDSWGHPALTTYVaPPaAI----KFNKVVLGLDIYVSG 162 Komagataella ph...
EFJ00017      29 PPPLPVGVQ----------------------ECTITVLQRDFANSYGDAEVVQLE-PPtECgdpgSWSAVSLNLTVTSNG 85  Schizophyllum c...
EMD38307      31 PPPLPQNTK----------------------QCTVQILERTFGFSFGDPEIVQLT-PPtDCgpvgSWAGISLNFTVTSNG 87  Gelatoporia sub...
XP_007395826  31 PPPLPQDAK----------------------QCTIQILERTFGNSFGDPEIVQFT-PPtDCgsvgSWAGISLNFTVTSNG 87  Phanerochaete c...
ERT01665     184 RQFDRLALMYLNDTEVWRTSTAEPVKApGIRWVYLKDTTAYLALWR-TPQKIIFDLGNLQNDVYTASFNVTLTATFFQSD 262 Sporothrix sche...
EDN94889     273 RQFDRLAIMYFGDSEVWRTSTAEPTTA-GIRWEYLKDMTEYLYFWN-SPQTLIFDLGNLIDSTYTGYYYTTLTATFFTSQ 350 Sclerotinia scl...
EGZ74538     239 RQYDRLALMYLGDTEVWRTSTAEPVAPpGIRWEYLKDMTEYLSLWQ-QKQKIIFDLGNLVNDKYTGIFNTTLTATFFYSD 317 Neurospora tetr...
Q0UTT9       109 RQFDRLALMYLDDIEVWRTSTAEPTSS-GIIWTYTKDMSAYSVLFR-SPHKLIFDLGNLIDDTYTGSWNTTLTATFFTAD 186 Parastagonospor...
XP_006685489 195 VQYDRLAHLFVSGVEVWRTSTIEPGGK-PSHSNFVKDVSDYAILFQ-DEATLSFSLGNIVNDKYTGSFELNMYIDYYYDE 272 Yamadazyma tenu...
EDK36913     208 VQYDRLANLFVNGVEIWRTSTAEPGGR-SIVSLATKDVSVYTELFR-NPASILFDLPNILTGRLTGSFHVQLSIQLYDSH 285 Meyerozyma guil...
XP_002494029 163 VQYDRLAHIYLDGSPLWRTSTPEPGNR-HVHSLSHKDVSEYVPLFKeNGTELMVQLDNLLTGRLNGSFEVTLTARYYDSF 241 Komagataella ph...
EFJ00017      86 TQYDRLGIFTFQNVEIWRTSTPEPTRGdGIIWTYIKDVTQYIPLFA-KPGTFILQLDNIIQDNLDGVYSTTVTATYYAAT 164 Schizophyllum c...
EMD38307      88 TQFDRLGIFTFQNVEIWRTSTPEPTIGdGIIWTYIKDVTRYIPLFS-KPGTFILQLDNLLETGLDGQYATILQATFFASS 166 Gelatoporia sub...
XP_007395826  88 TQFDRLGIFTFQNVEIWRTSTPEPNIGdGIIWTYLKDVTRYLPLFA-KPGTLILELDNLLETGLDGQYATTLHATFFASS 166 Phanerochaete c...
ERT01665     263 vgd---------------------rldAAPPSDAVIPISKRQSDVNGVSQFTLPAD-VATNTITdFPRNARRAVFSVSAN 320 Sporothrix sche...
EDN94889     351 e--------------------------TVEPADLILPISARHGADDSVSVFTLPGD-NATNTIA-FPRNANRAVFSISAC 402 Sclerotinia scl...
EGZ74538     318 va-----------------------tnAAPPSDLIIPISARQSANNAVSQFTLPTQ-NATNTISdFPLNARRAVFSVSAN 373 Neurospora tetr...
Q0UTT9       187 d--------------------------TTKPADIILPVSARRSAANQPSAFVVPDT-KAINTLE-LPKNTEKAVFTISAC 238 Parastagonospor...
XP_006685489 273 tvgsqfgpvp-------dinditdlilTNTLPSKIVSLG---STSESSPQISLPDT-QFIAQLPeLNTNTSKLRLSIFTS 341 Yamadazyma tenu...
EDK36913     286 geadesdpe---------iqskasifsTHKPASRVHAILP--SRPHKPSVVYLPSD-KIRVQLPtVPQNTTRLRLSILTS 353 Meyerozyma guil...
XP_002494029 242 lndtapvkiagidddlfipgshvqffsANEAASKVFPLVD--TPPTRPPLIYYPDR-KFQVTLPvLSPNTTRVKLALFTS 318 Komagataella ph...
EFJ00017     165 ge-----------------------ypTAKQADTILPIST--GANDTGNDASVPPGfSTNVT---IPVNTIKLFAEIFAS 216 Schizophyllum c...
EMD38307     167 pe-----------------------hpPAPKANTIIPVTT--LANNTGNEASVPPDfSLNVT---VPRNAVQIFAELYAS 218 Gelatoporia sub...
XP_007395826 167 aq-----------------------npPAPRADLIVPITT--LANNTGNDASVPPIfSLNIT---LPQNTVEVYAELQAS 218 Phanerochaete c...
ERT01665     321 GQANEEFWWSNVLQSDTLTFNATgAGVFPGFSPFREVQVLIDGQLAGVQWPFPVVFTGGVVPSLHRPIVGADVFDLREHE 400 Sporothrix sche...
EDN94889     403 GQSTEEFWWGNVLQSDIEAFEDY-DGTLYGYSPFREVQVLIDGQLAGVQWPFPVVFTGGIVPGLWRPIVGLDAFDLREHE 481 Sclerotinia scl...
EGZ74538     374 GQGNEEFWWSNVLQSDTNAFSDT-VGELPGYSPFREVQILIDGHLAGVYWPFPVIFTGGVVPSLHRPIAGIEAFDLKEHE 452 Neurospora tetr...
Q0UTT9       239 GQAAEEFWWSNVFNSDTKAFGN--DTTLYGHSSFRELQLLIDGNLAGVAWPFPVIFTGGIVPGFWRPVVGIDAFDLKEDE 316 Parastagonospor...
XP_006685489 342 GNSQEEFWYTNILDAYVSGFAAE-GVEFYGHGPIRHVEVYFDGQIVAAVAPDPVIFTGGISPSLWSPVVSNDAFDLKPIN 420 Yamadazyma tenu...
EDK36913     354 GNAAEEFWYANVLDKYAHRFDEQ-GNTLQGHGPTRFVNVNFNGEKIATQTPDPIVFTGGISPALWSRVVATRAFDLPTID 432 Meyerozyma guil...
XP_002494029 319 GNAAEEFWYSNILDGFEDYFSDH-QHYLAPHGPCRMVNVYINGIRIASLSPEPIIYTGGISPALWSPIVSTSAFDVRALE 397 Komagataella ph...
EFJ00017     217 GNGQEEFWYGNIPNAYLSSLP---DGLTYGQGPFREVRLLIDGRVAGVAFPFPVIFTGGFSPPAWRPINAINALDLPRYA 293 Schizophyllum c...
EMD38307     219 GNGNEEFWYFNTADEFVNDLP---AGFTFPDGPFREVRMLVDGQLAGVAFPYAVIFTGGILPSCWRPITSYGALDLPTYF 295 Gelatoporia sub...
XP_007395826 219 GNGDEEFWYFNTANEFINDLP---SGESLPNGPFREVRLLVDGQVAGTAFPYPVIFTGGIAPPAWQPITSYGALDLPNYY 295 Phanerochaete c...
ERT01665     401 IDISPWLPVLCDGQ---PHTFSILVAGLDDd--gQPSGV-ASLTKQVAASWYVTGKIFVWLDDND-----GDDSSALVTT 469 Sporothrix sche...
EDN94889     482 IDITPWLPILCDGS---EHTFEIRVAGVID----DEEGS-GTLIDTVGSYWLVTGKIFIWLDSND-----------SVTT 542 Sclerotinia scl...
EGZ74538     453 IDITPWLAVLTDGK---PHEFTIRIAGINDtassSSSGHnAVLTDHVNESWYVTGKIFIWTDSHShsnsiGSNNNNNNND 529 Neurospora tetr...
Q0UTT9       317 IDITPFLPLLNDGN---THAFEIRVVGIDD----DGKGN-GQLTENIESNWVVTGKIFIWTGTAM-----------NLSI 377 Parastagonospor...
XP_006685489 421 IELTVLLPKIQANP---DGKLEIKIDNGVD-------------HKSVGSNWITTANLHVWENSHV-----ESSTGSSSQA 479 Yamadazyma tenu...
EDK36913     433 LDVTGLLPLLWEHQavtDRILEIEISNGID----ESNRPfLPEHSQIGENWITSANLLSWENSEV-----VESSGDIVNI 503 Meyerozyma guil...
XP_002494029 398 FDLSTILPYLWDSE---DTVLEVEISNCIQ----DQEETeASAGNTIGQNWVTSANLLTWEHSSI-----KSSEGTVISN 465 Komagataella ph...
EFJ00017     294 IDVTPFVPLLTDGE---PHNYTLDVASAEE-------------DHAILGNWYVSGLLQVVTGNSE-----GRTTGNMTVY 352 Schizophyllum c...
EMD38307     296 IDLTPFVPVLTDGN---PHNITIDVTSAEA-------------DHAINQNWFVSGNLQVVTDPSP-----KPTTGTITVY 354 Gelatoporia sub...
XP_007395826 296 LDVTPFVPLLVDGN---PHNFSLDVVSAET-------------DHTINQNWFVSGLLQVITDPSG-----KPTTGKINVY 354 Phanerochaete c...
ERT01665     470 GTP--PVVHDAGV--AISVTQHLQQN-ATGANQTLTYSVSVARSFSVQGTlrtgakgprAVSWSQSLSYANEGALTDFGN 544 Sporothrix sche...
EDN94889     543 GTA--PKIFLPAP--IITTSHVLTQN-ASGANETLTYITNVQRSLSISSTiite-ngttTSTWTQELSALNYGQYTAFGA 616 Sclerotinia scl...
EGZ74538     530 NKL--PTIDGLTPliTVSSIRAPPSSsNSSTPESITYTTSVKRSLRVRSP---------LVTWTQTLSYTNKGLVSAQGY 598 Neurospora tetr...
Q0UTT9       378 GTV--PIISAPAP--SIKLQSITKRS-VNGTVSALDYSIQVSRQLSVESTimts-agsqTVSWKQDLTFSNTGTLSNGGN 451 Parastagonospor...
XP_006685489 480 LTN---RYCTQIVinSTSLHQTLVCEdDVKLHSSLSFTLADSSVVSG------------PVELEFKTSTTNIQIISSDGL 544 Yamadazyma tenu...
EDK36913     504 DDKarATVVSLAPpfSGTIQQVITSIlNTEVTSNLTFVLENDQEIKT------------TVTALTKGEIANVQHYSHFGS 571 Meyerozyma guil...
XP_002494029 466 DNS--TEIKAKIFpgDSKLTQIVSARyKTAISAQLNYTFFNGSSLNI------------LFNNVYDSSQSNVQLYADYGN 531 Komagataella ph...
EFJ00017     353 EVG--EYAETDTTg-------------GNTTEGAFEVEVDAKRSVHIESVlvdgdgeetTVVWAQDLGYTSKQTFSADYL 417 Schizophyllum c...
EMD38307     355 DAQ--PFAVSNISg-------------SVATNGDIIVTVNASRSIHIEADivsgsgahtHVVWSQQMEFSNTQFYLDDLI 419 Gelatoporia sub...
XP_007395826 355 QAS--PFAETSTTg-------------SVGSNGDVNVTVKATRNIHVESTiisgsgtttNVVFTQSSSYSNTQNFLNNTF 419 Phanerochaete c...
ERT01665     545 NQINNFTLSGSDKASGDG--DAASKYSysTSYAYPT 578 Sporothrix schenckii ATCC 58251
EDN94889     617 IQINNATTYGIDTS------KLGSSTKykSEYTYPV 646 Sclerotinia sclerotiorum 1980 UF-70
EGZ74538     599 NQFNDMLISGSESSS--S--SSSSTHDyeTSYTFPL 630 Neurospora tetrasperma FGSC 2509
Q0UTT9       452 DQVDQQATKGTSI----------SSTGfsRSFDYPL 477 Parastagonospora nodorum SN15
XP_006685489 545 DQSVVHTGNTKMTVGVGS-------SYenIEFTYPL 573 Yamadazyma tenuis ATCC 10573
EDK36913     572 VQSVVHVGHSSKNVTIAT--ENDELYKldTSYSYPL 605 Meyerozyma guilliermondii ATCC 6260
XP_002494029 532 KQHVALIPSTKHSISLFDlkNQKEIYEvnSTFSYPL 567 Komagataella phaffii GS115
EFJ00017     418 VQLIDQSTTGTITSTHNG--DTVVSDE----FSYPL 447 Schizophyllum commune H4-8
EMD38307     420 IQNVVQTASGTFLSTHNG--VTALQDI----FSYPL 449 Gelatoporia subvermispora B
XP_007395826 420 IQNVQQTATGSVLSTHNG--VASTVDN----YSFPL 449 Phanerochaete carnosa HHB-10118-sp
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap