1V0E


Conserved Protein Domain Family
End_tail_spike

?
pfam12219: End_tail_spike 
Click on image for an interactive view with Cn3D
Catalytic domain of bacteriophage endosialidase
This domain family is found in bacteria and viruses, and is approximately 160 amino acids in length. There are two conserved sequence motifs: VSR and YGA. This domain is the C terminal domain of the bacteriophage protein endosialidase. The endosialidase protein forms homotrimeric molecules and this domain complexes into a tail-spike stalk. The stalk region folds in a triple beta-helix that is interrupted by a small triple beta-prism domain. The tail-spike is a multifunctional protein device used by the phage to fulfill the following functions: (i) to adsorb to the bacterial polySia capsule (ii) to de-polymerize the capsule to gain access to the outer bacterial membrane, and finally (iii) to mediate tight adhesion to the membrane, a prerequisite for the initiation of the infection cycle.
Statistics
?
PSSM-Id: 152654
View PSSM: pfam12219
Aligned: 5 rows
Threshold Bit Score: 274.431
Threshold Setting Gi: 75095342
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1V0E_B            512 PDNRVSRDFRYGAVPNRAVPVFFDTNGVRTVPAPMEFTG-----DLGLGHVTIRASTSSNIRSEVLMEGEYGFIGKSIPT 586  Enterobac...
ABP02011          546 NDSRVSRKFTYGATPGQAIPTFMGTDGIRTIPAPLHLSGevvaaDMTVEHLTLKASTSANIRSEMLMEREYGFIGKTIPK 625  Enterobac...
P49714            546 NDNRVSRKFTYGATPGQAIPTFMGTDGIRNIPAPLYFSDnivteDTKVGHLTLKASTSANIRSEMQMEGEYGFIGKSVPK 625  Escherich...
ecoli:ACK-0174131 663 QEEFVSRDFVYGATPNRTLPTFMSTSGVRTVPVPVDFTD-----DVAVQSLTVHAGTSGQVRAEVKLEGNYAIIAKKVPS 737  Enterobac...
O80102            694 DHPYVSRDFKYGATPNRTIPVAMGVDGVRHVEAPLTFDNdvsvySLHVTGLEYDGTQQSAVRAR--FDGDYGLISKTVPT 771  Phage #D
1V0E_B            587 DNPAGQRIIFCGGEGTSSTTGAQITLYGANNTDSRRIVYNGDEHLFQSADVKPYNDNVTALGGPSNRFTTAYLGSNPIVT 666  Enterobac...
ABP02011          626 DNPTAQRVIISGGGGTAADTGAQITLHGAGSSTSRRAVYNANEHLFQSGAIMPYNDNVYPAGGPRNRFTTIHLTSDPIIT 705  Enterobac...
P49714            626 DKPTGQRLIICGGEGTSSSSGAQITLHGSNSSNAKRITYNGNEHLFQGAPIMPAVDNQFAAGGPSNRFTTIYLGSDPVTT 705  Escherich...
ecoli:ACK-0174131 738 DDVTAQRLIVSGGETTSSADGAMITLHGSRSSTPRRAVYNALEHLFENGDVKPYLDNVNALGGPGNRFSIVYLGSNPVVT 817  Enterobac...
O80102            772 KTPSRQRLIVSGGDGASSSDGALLQLYGSNHATPNRAIMYASGGFYSYNNFLPYLDSQVSLGSASNRWTTVYATTGTINT 851  Phage #D
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap