3GVL


Conserved Protein Domain Family
End_beta_propel

?
pfam12217: End_beta_propel 
Click on image for an interactive view with Cn3D
Catalytic beta propeller domain of bacteriophage endosialidase
This domain family is found in bacteria and viruses, and is typically between 443 and 460 amino acids in length. This domain is the highly conserved beta propeller of bacteriophage endosialidase which represents the catalytically active part of the enzymes. This core domain forms stable SDS-resistant trimers. There is a nested beta barrel domain in this domain (pfam12195). The endosialidase protein complexes to form a homotrimeric molecule.
Statistics
?
PSSM-Id: 152652
View PSSM: pfam12217
Aligned: 4 rows
Threshold Bit Score: 861.173
Threshold Setting Gi: 75091984
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3GVL_A             73 QGELFKITDTPYYNAWPQDKAFVYENVIYAPYMGSDRHGVSRLHVSWVKSGDDGQTWSTPEWLTDLHPDYPT------VN 146 
ecoli:ACK-0174131 213 QGELFKITDTPWYNAWTQDKTFVYDNVIYAPFMAGDRHGVNNLHVAWVRSGDDGKTWTTPEWLTDLHENYPT------VN 286  Enterobac...
Q9AZ46            103 NGELYKITDNPYYNAWPQDKAFVYENVIYAPYMGSDRHGVSRLHVSWVKSGDDGQTWSTPEWLTDLHPDYPT------VN 176  Escherich...
O80102            234 NGSLTKVTDTPFYNAWTQDKTFVYDHVIYAPFMAGERHGVQNLHVAWVRSGDDGQTWSMPEWLTPIHADYNAsvsadrVN 313  Phage #D
3GVL_A            147 YHCMSMGVCRNRLFAMIETRTLAKNALTNCALWDRPMSRSLHLTGGITKAANQRYATIHVPDHGLFVGDFVNFSNSAVTG 226 
ecoli:ACK-0174131 287 YHCMSMGVVRNRLFAVIETRTVSGNKLQVAELWDRPMSRSLRVYGGITKAANQQVAYIRITDHGLFAGDFVNFSNSGVTG 366  Enterobac...
Q9AZ46            177 YHCMSMGVCRNRLFAMIETRTLAKNKLTNCALWDRPMSRSLHLTGGITKAANQQYATIHVPDHGLFVGDFVNFSNSAVTG 256  Escherich...
O80102            314 YHCMSMGTCGNRLYAVIETRYLSNMRMKKAELWSRPMPYFRHPTGGITISSGSTTATIVIENHGLKAGDAVNFSNTAATG 393  Phage #D
3GVL_A            227 VSGDMTVATVIDKDNFTVLTPNQQTSDLNNAGKNWHMGTSFHKSPWRKTDLGLIPS-------VTEVHSFATIDNNGF-- 297 
ecoli:ACK-0174131 367 VTGNMTVTTVIDKNTFTVTTQNTQDVDQNNEGRYWSFGTSFHSSPWRKTSLGTIPSfvdgstpVTEIHSFATISDNSF-- 444  Enterobac...
Q9AZ46            257 VSGDMTVATVIDKDNFTVLTPNQQTSDLNNAGKSWHMGTSFHKSPWRKTDLGLIPS-------VTEVHSFATIDNNGF-- 327  Escherich...
O80102            394 VSGNMTVASIINRNTFTVTLSSPAGSTINNAGVTWNFATRFWDSPWEITELPEVAYstnadlcVTETHSFAVIDDANYti 473  Phage #D
3GVL_A            298 AMGYHQGDVAPREVGLFYFPDAFNSPSNYVRRQIPSEYEPDASEPCIKYYDGVLYLITRGTRGDRLGSSLHRSRDIGQTW 377 
ecoli:ACK-0174131 445 AVGYHNGDIGPRELGILYFSDAFGSPGSFVRRRIPAEYEANASEPCVKYYDGILYLTTRGTLSTQPGSSLHRSSDLGTSW 524  Enterobac...
Q9AZ46            328 VMGYHQGDVAPREVGLFYFPDAFNSPSNYVRRQIPSEYEPDASEPCIKYYDGVLYLITRGTLGDRLGSSLHRSRDIGQTW 407  Escherich...
O80102            474 AVGYHNDDVSPRRLGVLYFSNVYDNPGVFVRRTVAQAYADNASEPCVKSYGGVLYLTTRGTLPTSPGSTLAMSTDSGQNW 553  Phage #D
3GVL_A            378 ESLRFPHNVHHTTLPFAKVGDDLIMFGSERAENEWEAGAPDDRYKASYPRTFYARLNVNNW--NADDIEWVNITDQIYQG 455 
ecoli:ACK-0174131 525 NSLRFPNNVHHSNLPFAKVGDELIIFGSERAFGEWEGGEPDNRYAGNYPRTFMTRVNVNEW--SLDNVEWVNVTDQIYQG 602  Enterobac...
Q9AZ46            408 ESLRFPHNVHHTTLPFAKVGDDLIMFGSERAENEWEAGAPDDRYKASYPRTFYARLNVNNW--NADDIEWVNITDQIYQG 485  Escherich...
O80102            554 SYLRFPNNVHHSNLPFAKVGDYLYIFGTERAFGEWEGGAPDSRYEGSYPRTFMCKVNVSSWpsSLDDVQWFNITDQIYQG 633  Phage #D
3GVL_A            456 GIVNSGVGVGSVVVKDNYIYYMFGGEDHFNPWTYGDNSAKDPFKSDGHPSDLYCYKMKI 514 
ecoli:ACK-0174131 603 GIVNSAVGVGSVCIKDNWLYYIFGGEDFLNPWSIGDNNRKYPYVHDGHPADLYCFRVKI 661  Enterobacteria phage CUS-3
Q9AZ46            486 DIVNSSVGVGSVVVKDSYIYYIFGGENHFNPMTYGDNKGKDPFKGHGHPTDIYCYKMQI 544  Escherichia virus K1-5
O80102            634 HIVNTAVGVGSVCVKDGWLYYIFGGEDFFSPWSIGDNSAKLWYKHDGHPADLYSYRIKI 692  Phage #D
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap