5VBN


Conserved Protein Domain Family
Dpoe2NT

?
pfam12213: Dpoe2NT 
Click on image for an interactive view with Cn3D
DNA polymerases epsilon N terminal
This domain is found in eukaryotes, and is approximately 70 amino acids in length. The family is found in association with pfam04042. There is a single completely conserved residue F that may be functionally important. This domain is the N terminal domain of DNA polymerase epsilon subunit B. It forms a primarily alpha helical structure in which four helices are arranged in two hairpins with connecting loops containing beta strands which form a short parallel sheet. DNA polymerase epsilon is required in DNA replication for synthesis of the leading strand. This domain has close structural relation to AAA+ protein C terminal domains.
Statistics
?
PSSM-Id: 371965
View PSSM: pfam12213
Aligned: 9 rows
Threshold Bit Score: 107.085
Threshold Setting Gi: 21431777
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5VBN_A         4 ERLRSRALSAFKLRGLLLRGEAIKYLTEALQSISELELEDKLEKIINAVEKQPLSSNMIERSVVEAAVQEC 74 
XP_001632217   3 DPLRKKVLSTFRLNGLSLQSDATKYLRDVLVPLSEPEIEDWLEKIVETVQKQPLSSTLVDREVVETAVQEC 73  starlet sea anemone
Q19196         8 NALRREIVKTFQIHAFELKKEAVKLCVKLFLDHDKETRKKWTNKMIELLKKQTLQSSLISEELIRDTFRQC 78  Caenorhabditis elegans
Q17H49         5 AKLRAQIVSWFNISGFQIRSEASNFLAQQIAPLGKAARKRWLEDIASHVQGQNLDLPAVEKSHIELAIKEA 75  yellow fever mosquito
Q29E58         6 IPLRKRITNNFKLCGFLIRSENSTYLAEQLLPFDADERDKWLTVITENLQGQKLATPHVERAALEKAINEL 76  Drosophila pseudoobscura
A7YWS7         4 ERLRSRALSAFKLRGLMLRGEAVKYLTEALQSINEIELEDALEKIIDAVEKQPLSSNMIERSVVEAAVQEC 74  cattle
Q5ZKQ6         4 ERLRRRLGSAFRVRGLLLRAEAVKYLTETLESLNEEEFEDVIDKIIDAVEKQPLSTNMIELSTVEAAVQEC 74  chicken
CAG10412       3 RRIKSRVSAAFKMRGLVLRPEASKYLVEVLESVGPSELEDVIEKVLDAVEKQPLSSNMIELSVVESAVQDC 73  spotted green pufferfish
KAE8586522    39 DKLKSKVTSAFKMHGLLLRAEASKYLSEVLSSVNEVELEDVIDSIIDAVEKQPLSSNMIEKSTVETAVQEC 109 tropical clawed frog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap