3F1I


Conserved Protein Domain Family
Hrs_helical

?
pfam12210: Hrs_helical 
Click on image for an interactive view with Cn3D
Hepatocyte growth factor-regulated tyrosine kinase substrate
This domain family is found in eukaryotes, and is approximately 100 amino acids in length. The family is found in association with pfam00790, pfam01363, pfam02809. This domain is the helical region of Hrs which forms the core complex of ESCRT with STAM.
Statistics
?
PSSM-Id: 403434
View PSSM: pfam12210
Aligned: 18 rows
Threshold Bit Score: 120.857
Threshold Setting Gi: 1253269655
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3F1I_H         4 QFLKALQNAVTTFVNRMKSNHMRGRSITNDSAVLSLFQSINGMHPQLLELLNQLDERRLYYEGLQDKLAQIRDARGALSA 83   human
ESO09504     408 QFLKALSSSIEIFVNRMKSNSQRGRNITNDSSVQTLFMTLNAMHPTLLKYISQQEDNRAHYESLQDKLSQLKDARDALDV 487  Helobdella rob...
EKC32062     377 QFLRALHSSLEIFVNRMKSNSQRGRSIANDSSVQSLFNVITNMHPQLMKYTQEQEDMRGHYESLQDKLAQLRDAREALDA 456  Pacific oyster
CUT99464     423 EFLTALRKSLDVFSNRMRVCSQRGRQVATDSTLQTLFKTLHQMNLQLMQYSNDLEVRRTSLEKLQDQTAQIREAREALDD 502  Echinococcus m...
PDM64164     517 mctqeCMHEVTMMDSRIRSNVARGRSIINDSAILPLFEKLTNWHGEVLARMAKLDEDRAHLESLQDHLAHIGEARQAMDA 596  Pristionchus p...
CDQ04558     427 EFCRQLVEQVTVMDNRIRSNVARNRSVVNDTAIQSLFIRLTEMHAQVMARMNKLEDQRNHFESLQDSLAHIQEARQAIDA 506  Brugia malayi
XP_001636928 134 TLVNNFRSSVEMLMERMQDISGKGKHVAMDATVQSLFQTVSAMHPQLLRLVEQQEQETGKYEGIQERLGLVKEARATLEG 213  starlet sea an...
XP_004346143 442 EILETMKASLTLFEEKLQQAAMKGVPLNQDASVKSLFQTLSVMHPRLMKRIEENEELRREFTAVEQDLDKVQEAKKTLDE 521  Capsaspora owc...
XP_009861236 389 EFLNNLRTSVEIFTNRMRSNKMRGRSIANDSAVQGLFQSINNMHPLLMKTMNELEEKRLQQEALQDKLVQLRDARAALDA 468  vase tunicate
Q17796       403 KWCQSIREQVSVMDNRIRSNLARGRPVFNDSAIQDLFTKLTELHSHVLSRMHTLDEQRGYYESLQDHLANIGEARQAIDE 482  Caenorhabditis...
3F1I_H        84 LREEHREKLRRA-AEE 98   human
ESO09504     488 LREEHREKTRRK-QEE 502  Helobdella robusta
EKC32062     457 LREDYREKKRRE-QEE 471  Pacific oyster
CUT99464     503 LRRDYAEQRRRE-EEE 517  Echinococcus multilocularis
PDM64164     597 LREEHGRRMREE-EEE 611  Pristionchus pacificus
CDQ04558     507 LREDHERQKQARiMEE 522  Brugia malayi
XP_001636928 214 AREAHREKLRQQ-ELE 228  starlet sea anemone
XP_004346143 522 IRRQHQVKLKQQ-QEE 536  Capsaspora owczarzaki ATCC 30864
XP_009861236 469 LRADHARKVRQA-AEE 483  vase tunicate
Q17796       483 MREEHERKRQERmAEE 498  Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap