3F3B


Conserved Protein Domain Family
DUF3599

?
pfam12206: DUF3599 
Click on image for an interactive view with Cn3D
Domain of unknown function (DUF3599)
This family of proteins is found in bacteria. Proteins in this family are approximately 120 amino acids in length. This domain is the phage-like element pbsx protein xkdh.
Statistics
?
PSSM-Id: 403432
View PSSM: pfam12206
Aligned: 5 rows
Threshold Bit Score: 196.615
Threshold Setting Gi: 505404993
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3F3B_A         2 SYRQXLIHRCDIYH-EAAQApSAGRFGIPADRLQPVISYPDTPDEQDVPCYFTEKTQQLIQEEPDQTVYHSFLVHFPLSA 80  Bacillus subtilis
Q65L27         2 SYKRLLSDRCDIYHlKEDQA-EEARYGIPARDLQPIRTYGETPDLQNVPCYFTEKNQSIVQQDPEQVIYHSYLAHFPAEA 80  Bacillus lichen...
WP_012011045   2 SYQSLLTDRCDLFHlEHQEA-SRGKFGIPADDLQMTLSYPDAPSLTDLSCYVIEKNQSLVQEEPNTVIYQSYLVHFPLAS 80  Bacillus pumilus
WP_015592095   2 SYQDLLTDRCAVYHlVENQ--EAGSFGVPG---ETAYSYPVLSDLQNVSCLFAKESTKVVKEEPGVEIVQSFRVHFLINT 76  Bacillus sp. 1N...
P45924         2 SYQSLLTHRCDIYHlQEKKEnRKQKFGVPVEDVQPVFSYPDEPDIENQPCYFTEKSQSIIQQESNVSIYQSFLVHFPATA 81  Bacillus subtil...
3F3B_A        81 DIRVNDKIIWENHKYILKLPKRIRHHHWEVVAVRDE 116 Bacillus subtilis
Q65L27        81 DVRLHDKAVWNGVAYTLQQPRNIKGHHLEVLAVRDE 116 Bacillus licheniformis DSM 13 = ATCC 14580
WP_012011045  81 DIRLHDKMVWNGVSLKLQQPKIVKNHHIEVMAVRKE 116 Bacillus pumilus
WP_015592095  77 DVRFNDKIVLNGTSYRLEIPRNIRGHHIEVTAIRNd 112 Bacillus sp. 1NLA3E
P45924        82 DIRVNDRAVWDGTAYKLQKPRKIRNHHWEVTAVREV 117 Bacillus subtilis subsp. subtilis str. 168
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap