2AFF


Conserved Protein Domain Family
hNIFK_binding

?
pfam12196: hNIFK_binding 
FHA Ki67 binding domain of hNIFK
This domain family is found in eukaryotes, and is approximately 40 amino acids in length. The family is found in association with pfam00076. There are two conserved sequence motifs: TPVCTP and LERRKS. This domain is found on the human nucleolar protein hNIFK. It binds to the fork-head-associated domain of human Ki67. High-affinity binding requires sequential phosphorylation by two kinases, CDK1 and GSK3, yielding pThr238, pThr234 and pSer230. This interaction is involved in cell cycle regulation.
Statistics
?
PSSM-Id: 403426
View PSSM: pfam12196
Aligned: 23 rows
Threshold Bit Score: 57.0763
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2AFF_B         2 TVDXQGPXPVCXPTFLERRKS-QVAELNdDDKDDEIVFKQP 41 
Q91VE6       250 SVDSQGPTPVCTPTFLERRKS-QVMEVG-GDKDDEIILKLP 288 house mouse
Q5RJM0       206 SEANQDPTPVCTPTFLERRKS-QLMEIN---DDDEIILKLP 242 Norway rat
Q8JIY8       204 SVCSEDVTPVCTPSLLERRKS---LRVEdDDVDDEIVIKVK 241 zebrafish
XP_003962223 208 SSCSEDATPVCTPSVLEKRKS----MVVdDNADDEVVVKMP 244 torafugu
XP_005815980 206 SSCSDQTTPVCTPSFLERRKS---TVVLdDEEDSEIILKMP 243 southern platyfish
XP_013130980 208 SSCTDDSTPVCTPSFLERRKS----TAAeNDADDEIIIKMP 244 Nile tilapia
XP_422088    210 SLTSQDPTPVCTPTVLERRKA---QQADdDPDDNEIIIKLP 247 chicken
XP_001519520 162 TVDSQAPTPVCTPTFLERRKS-VALGMS--EEDNEIILKLP 199 platypus
Q6GL69       200 SVSSQDPTPVCTPTVLERRKSvRLEQNDeDDDDGEVVLKLP 240 tropical clawed frog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap