Conserved Protein Domain Family
stn_TNFRSF12A

?
pfam12191: stn_TNFRSF12A 
tumor necrosis factor receptor stn_TNFRSF12A_TNFR domain
This family of proteins is found in eukaryotes. Proteins in this family are typically between 129 and 184 amino acids in length. This is the stn_TNFRSF12A_TNFR domain from the tumor necrosis factor receptor. The function of this domain is unknown.
Statistics
?
PSSM-Id: 403424
View PSSM: pfam12191
Aligned: 3 rows
Threshold Bit Score: 187.508
Threshold Setting Gi: 958815895
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_003417804   1 MALGPLRPLLRLLVLGLWLALLCAAAGERTPGAAPCPRGTSWSSDLDKCMDCASCPVRPRSDFCLGCATAPPAPFPLLWP 80  African savanna...
EDM03764       1 MAPGWPRPLPQLLVLGFGLVLIHATAGEQAPGNAPCSSGSSWSADLDKCMDCASCPARPHSDFCLGCAAAPPAHFRMLWP 80  Norway rat
XP_014688664   1 MIPGPLRPRLRFLVLGLGLALLRAAAGEPVPGTTPCSRGSSWSADLDKCMDCASCPARPHSDFCLGCAAAPPASFRLLWP 80  ass
XP_003417804  81 ILGGALSLALVVGLLSGFLVWRRCRRREKFTTPIEETGGEGCPGVALIQ 129 African savanna elephant
EDM03764      81 ILGGALSLALVLALVSGFLVWRRCRRREKFTTPIEETGGEGCPGVALIQ 129 Norway rat
XP_014688664  81 ILGGALSLALVLGLLSGFLVWRRCRRREKFTTPIEETGGEGCPGVALIQ 129 ass
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap