Conserved Protein Domain Family
amfpi-1

?
pfam12190: amfpi-1 
Fungal protease inhibitor
This protein family is found in eukaryotes, and is approximately 50 amino acids in length. These proteins are fungal protease inhibitors.
Statistics
?
PSSM-Id: 371952
View PSSM: pfam12190
Aligned: 2 rows
Threshold Bit Score: 129.809
Threshold Setting Gi: 1573751827
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
OWR43513      12 CLLALAYGDLVCGSSYCKQNPCSNkiAASSCRSPSVYRANHAGKCACCPACVTLLSEGAACKVYSKELGETPSAVCKEPL 91  Danaus plexippu...
XP_028040364  12 CVASAAYGALVCGTDYCEKNPCIQ--PPLVCPKNTEHRARHAGKCACCPACVTLLGEGATCKIYSKELGETPSAVCKEPL 89  wild silkworm
OWR43513      92 KCLSGVCVKVA 102 Danaus plexippus plexippus
XP_028040364  90 KCIKRVCTKLV 100 wild silkworm
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap