3WUT


Conserved Protein Domain Family
EABR

?
pfam12180: EABR 
TSG101 and ALIX binding domain of CEP55
This domain family is found in eukaryotes, and is approximately 40 amino acids in length. This domain is the active domain of CEP55. CEP55 is a protein involved in cytokinesis, specifically in abscission of the plasma membrane at the midbody. To perform this function, CEP55 complexes with ESCRT-I (by a Proline rich sequence in its TSG101 domain) and ALIX. This is the domain on CEP55 which binds to both TSG101 and ALIX. It also acts as a hinge between the N and C termini. This domain is called EABR.
Statistics
?
PSSM-Id: 403418
View PSSM: pfam12180
Aligned: 10 rows
Threshold Bit Score: 44.7978
Threshold Setting Gi: 82192670
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3WUT_A        17 EIQLKDALEKNQQWLVYDQQREVYVKGLLAKIFE 50 
XP_006630145 255 KQQVAYVENLNAKWQKYDSSREEFVKGLCQKLKQ 288 spotted gar
Q99JG7       215 KQKVTHVEDLNAKWQRYDASRDEYVKGLHAQLKR 248 house mouse
Q502I3       164 QEQLRDALEKNQHWLVYDQQREAYVQGVLARIKD 197 zebrafish
XP_013131018 146 QIHLRDALEKNKQWLEYDQQREAYVRAILARMlw 179 Nile tilapia
EFB20889     171 EIQLKDALEKNQQWLVYDQQREAYVKGLLAKIFE 204 giant panda
PWA21387     252 D-QLKDALEKNQQWLVYDQQREVFVQSVVARTME 284 western mosquitofish
XP_012667741 215 KQKVLHVEDLNAKWQRYDTSRDEYVREIHAQLRE 248 small-eared galago
XP_692717    230 KKRVAYVESLNSKWQKYDSSREEYVRGLCQKLKE 263 zebrafish
TWW58841     229 KQRVAYVQNLNSQWQKYDSSRQDYIRSLCHRPKE 262 sansaifugu
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap