2QFA


Conserved Protein Domain Family
INCENP_N

?
pfam12178: INCENP_N 
Chromosome passenger complex (CPC) protein INCENP N terminal
This domain family is found in eukaryotes, and is approximately 40 amino acids in length. INCENP is a regulatory protein in the chromosome passenger complex. It is involved in regulation of the catalytic protein Aurora B. It performs this function in association with two other proteins - Survivin and Borealin. These proteins form a tight three-helical bundle. The N terminal domain is the domain involved in formation of this three helical bundle.
Statistics
?
PSSM-Id: 403416
View PSSM: pfam12178
Aligned: 13 rows
Threshold Bit Score: 53.8611
Threshold Setting Gi: 1708493
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2QFA_C         7 GPIHLLELCDQKLMEFLCNMDNKDLVWLEEIQE 39  
XP_019471025 132 GPTQLLEVCGQRLSRFLHDAEHKHLAWLREVEE 164  turkey
Q0IHP2         6 CLSHLLQVCARKTEEFVRTLDSKHMVWLLEIEE 38   tropical clawed frog
XP_023208879   7 SVRSLTEMFVGKTQEFINEIENVHMVWLEEIQQ 39   southern platyfish
XP_023362491   6 GSASILDLCGTKLMEFMCNVENKDMVWLQEIKE 38   Tasmanian devil
XP_011897473   7 GPIHLLELCDQKLMEFLCNMDNKDLVWLEEIQE 39   sooty mangabey
P53352         6 GLARLPVVCNQRLAELLRQVDDVDLLWLEEIHE 38   chicken
XP_007653122   7 GPIHLLDLCDQKLLDFVCNIDNKDLMWLKEIEE 39   Chinese hamster
XP_012957869   4 GPWRLLEVCEQRFSQFLHSAQHKHLAWLREVEE 36   mallard
CAG08782       7 SMQSLREMFVGKTQEFIDEITNVHLVWLDEIQQ 39   spotted green pufferfish
XP_026222268   7 SVRSLMQIFDGKAQEFINDIDNVHMVWLEEIQQ 39   climbing perch
XP_015194213  29 STDALLQVFQGKLRDFEEEVDSKHMVWLKEIEQ 61   spotted gar
XP_016851062   6 GPTHLLDVCNQKFSEFLFSAEYKYLVWLREIEE 38   green anole
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap