2KDT


Conserved Protein Domain Family
Proho_convert

?
pfam12177: Proho_convert 
Prohormone convertase enzyme
This domain family is found in eukaryotes, and is approximately 40 amino acids in length. The family is found in association with pfam01483, pfam00082. There are two completely conserved residues (Y and D) that may be functionally important. This protein is the C terminal domain of a prohormone convertase enzyme which targets hormones in dense core secretory granules. This C terminal tail domain is the domain responsible for targeting these dense core secretory granules. The domain adopts an alpha helical structure.
Statistics
?
PSSM-Id: 403415
View PSSM: pfam12177
Aligned: 9 rows
Threshold Bit Score: 62.843
Threshold Setting Gi: 226438096
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2KDT_A         5 LEGSEDSLYSDYVDVFYNTKPYKHRDDRLLQALMDILNE 43 
XP_005813881 733 FSGPGDSLYSDYSDGFYNIKPYKHRNDRLLQALFEMLDD 771 southern platyfish
XP_014351159 710 QKDSEDDLYNDYSDLFYNVKPYRHRDDRLLQALFELLKK 748 coelacanth
XP_007977229 709 LKDSEDSLYNDYVDVFYNTKPYKHRDDRLLQALVDILNE 747 green monkey
XP_003759876 712 LRNAENSLYSDYVDLFYSTKPYKHRDDRLLQALVDILKE 750 Tasmanian devil
XP_007254020 713 hRNPESSLYNHYRDSFYRNRAYRHRDEQLLQALFDMLDG 751 Mexican tetra
XP_017208229 713 YRASQNGLFNDYSDNFYRAQPYRHRDDRLLQALFDMLRD 751 zebrafish
XP_023810771 727 YHGAGDNIYSDYSDGFYNIKPYRHRDDRLMQALFQMLDD 765 Japanese medaka
XP_018555833 736 YRGPEDSVYSDYSDGFYSTKPYRHRDDRLLQALFEMIDd 774 barramundi perch
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap