Conserved Protein Domain Family
BacteriocIIc_cy

?
pfam12173: BacteriocIIc_cy 
Bacteriocin class IIc cyclic gassericin A-like
This class of bacteriocins was previously described as class V. The members include gassericin A, acidocin B and butyrovibriocin AR10, all of which are hydrophobic cyclical structures. The N- and C-termini are covalently linked, and the circular molecule is resistant to several proteases and peptidases. The immunity protein that protects Lactobacillus gasseri from the toxic effects of its bacteriocin, gassericin A, has been identified. It is found to be a small positively-charged hydrophobic peptide of 53 amino acids containing a putative transmembrane segment - a structure unlike that of the more common immunity proteins as found in pfam08951.
Statistics
?
PSSM-Id: 152608
View PSSM: pfam12173
Aligned: 3 rows
Threshold Bit Score: 88.5865
Threshold Setting Gi: 75424571
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O24790  1 MVTKYGRNLGLNKVELFAIWAVLVVALLLTTANIYWIADQFGIHLATGTARKLLDAMASGASLGTAFAAILGVTLPAWAL 80  Lactobacillus gasseri
Q48499  1 MVTKYGRNLGLSKVELFAIWAVLVVALLLATANIYWIADQFGIHLATGTARKLLDAVASGASLGTAFAAILGVTLPAWAL 80  Lactobacillus acidophilus
Q9ZGP5  1 MSKK--------QIMSNCISIALLIALI---PNIYFIADKMGIQLAPAWYQDIVNWVSAGGTLTTGFAIIVGVTVPAWIA 69  Butyrivibrio fibrisolvens
O24790 81 AAAGALGATAA 91  Lactobacillus gasseri
Q48499 81 AAAGALGATAA 91  Lactobacillus acidophilus
Q9ZGP5 70 EAAAAFGIASA 80  Butyrivibrio fibrisolvens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap