5FKV


Conserved Protein Domain Family
DNA_pol3_tau_5

?
pfam12170: DNA_pol3_tau_5 
Click on image for an interactive view with Cn3D
DNA polymerase III tau subunit V interacting with alpha
This domain family is found in bacteria, and is approximately 140 amino acids in length. The family is found in association with pfam00004. Domains I-III are shared between the tau and the gamma subunits, while most of the DnaB-binding Domain IV and all of the alpha-interacting Domain V are unique to tau. The extreme C-terminal region of this domain 5 is the part which interacts with the alpha subunit of the DNA polymerase III holoenzyme.
Statistics
?
PSSM-Id: 403409
View PSSM: pfam12170
Aligned: 31 rows
Threshold Bit Score: 149.289
Threshold Setting Gi: 81637209
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5FKV_E             1 ALEHEKTPELAAKLAAEAIERDPWAAQVSQLSLP--KLVEQVALNAWKEESDNA-VCLHLRSSQRHLNNRGAQQKLAEAL 77  Escherichia...
USMARC:WQG_12100 536 AILQERTPELVKKTIELSCQQDAWAKLANELNLG--GFSRQLALNSYMAEKRDDyIKLVLKPAMSRLNNDESRKNLADAL 613 Bibersteini...
ACL31725         527 AILQERTPELVKKTIELGCERDKWSRIVNSLKLG--GVSRQLALNSYLESHNNNhLLLVLNPTMAHLNSNEATQSLYNAL 604 Glaesserell...
Q7VKQ3           543 AILQDKTPELVAKTIELACEQDQWCQIINTLNLS--SFSRQIALNSYLAQTTAQqLDLVLKPSMSHLDNEESRKSLTLAL 620 [Haemophilu...
jgi:Asuc_0971    553 AILKEKTPELVKKVIALAEERDDWTKTVEHLGLDhlKLVKQIALNSVILAQTDSeIVLGLRSNQKHLQRESAIEALQAAL 632 Actinobacil...
WP_012341219     524 ailEQASPELIQRIIATAQERDDWTRIIEQLPLR--GMTKDMALNTVLLNQSGDqIVLSLMSDKQHL-LDRCHKELKQAL 600 Histophilus...
Q9CNR3           571 rLEQEITPELRAKVIDIARKQDFWTDCVESLDIQ--NLTKELALNCILLSHDGEvFHLGVRDNKAHLHTTNAQQQLQQAL 648 Pasteurella...
P43746           545 aILKDITPELRLKIITQTQQQDQWADIVERSGLT--GFSKELALNCFLQSKTDDeINLGLHSEKSHLRQDRSIKNLAEAL 622 Haemophilus...
Q6LTE8           612 ALEHEKTPEMAKLLVNEAANQDSWSDLVTKLNVG--RLVQQLALNSAFEQ-DNNqVTLYLRQSQSHLDNPKAREQLAQAI 688 Photobacter...
Q65U82           547 AILQEKTPEVITKVIAMADERDEWTKTVSQLHLDelKLVKQIALNSVVLIQHENeMKLGLRSAQKHLVRDKSVEILQDAL 626 [Mannheimia...
5FKV_E            78 SMLKGSTVELTIVEDDNPAVRTPLEWRQAIYEEKLAQARESIIADNNIQTLRRFFDAELDEESI 141 Escherichia coli K-12
USMARC:WQG_12100 614 K---AKGLDLELIIGEDDRYKTPLEIRRAIFEELTQAARVSLFADDKLKLLQQAFEAEIDESTI 674 Bibersteinia trehalosi USDA...
ACL31725         605 S---QQGFSSEMRIGESDEFQTPLEIRRVIFEQLTQEAKQALQADKKLKLLQQAFDAQMDEATI 665 Glaesserella parasuis SH0165
Q7VKQ3           621 A---DKGFTYKLVIGESAEHKTPLEIRRMIFEKLTLAAKQALNNDEKLMLLRDTFAAEIDESTI 681 [Haemophilus] ducreyi
jgi:Asuc_0971    633 KVYYGKDLRLKIELNDDERRPTPLDYRRQIYHELSERARQDLQADKKVKLLQQAFDAHLDLDSI 696 Actinobacillus succinogenes...
WP_012341219     601 SDFYQRDIQLLITPTDDKNLATPLYYQNLVYQEFNEQAKKALQEDNSLKLLEKEFAATLDLDSV 664 Histophilus somni
Q9CNR3           649 SQLQQQAMNVLISPTDSDNL-TPTEWYRQTYKALREKAQQALQQDEKLQLFLHEFSAEIElstv 711 Pasteurella multocida
P43746           623 SKLQGKDIRLTINL-DDSNVTTPIEYRRNIYQALREKAQNELQKDSKLQILLNEFDAKLDVESI 685 Haemophilus influenzae Rd KW20
Q6LTE8           689 GELQSVDIDLKIELSGKGQ--TPLEWREGLYQQKLGQAKESLESDANVTFIRQRFAAVLDEDSI 750 Photobacterium profundum
Q65U82           627 TKFYGKTINLTIDFNDDESLFTPLDHRRQIYQELSEQAKEDLLKDKKVRLLQDMFDAKLDMDSI 690 [Mannheimia] succiniciprodu...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap