Conserved Protein Domain Family
DNA_pol3_gamma3

?
pfam12169: DNA_pol3_gamma3 
DNA polymerase III subunits gamma and tau domain III
This domain family is found in bacteria, and is approximately 110 amino acids in length. The family is found in association with pfam00004. Domains I-III are shared between the tau and the gamma subunits, while most of the DnaB-binding Domain IV and all of the alpha-interacting Domain V are unique to tau.
Statistics
?
PSSM-Id: 403408
View PSSM: pfam12169
Aligned: 34 rows
Threshold Bit Score: 118.132
Threshold Setting Gi: 500018916
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_013299822   248 IGAADIRDMLGLVDRTQTWDLLGAAMAGDAKTALRLFREQYDGGADAGQVMRDLLSLTHLLTRTLVAGdEAAAHGQ-AGE 326  Parvularcula...
Q2GI84         242 LSENITKEMLGYVSRHTLLEIIEPLIIGNATEALNKFEEACNS-YNSVIILDNMLQIIYEICYFSI---TKKDNST-SDN 316  Ehrlichia ch...
Q30UQ4         232 LTVADARGILGLAGQELFFRVADAIRRQDCVGVSTVLRDVLDQGLDLGFFLRELTGMWRNLFMLRQAG-ESALPLLdLPE 310  Desulfovibri...
WP_011699634   232 LSDEEVLDVLGVIDRRSIHRTGTAVLEGDVRTCLDVVEDIYRRGMDIRRFCRQLCDYFRNLLVVAFGEgDSRRLD--LPS 309  Syntrophobac...
Q6MH32         248 LTRASVVEILGLTDRALLFETLNALIDRNSQAVLKVIEKIAAAGFEPHLYSQDLLEMIRNLLLIKVSEaQASQILE-MPD 326  Bdellovibrio...
jgi:Sama_1310  232 VRLAQVQTMLGAIDKGQILNLFDALCQGDIETLLTTARTAMGFGADADEVLRALLELLHQISLAQFAP-A-TASI----S 305  Shewanella a...
jgi:Shew_2235  232 VRLTQVQTMLGTIDEHHVIVLLKALCDGDVDLLMKVTGDVLSFGADPHEVLRSLLELLHQITLTQFAP-S-AAQL----S 305  Shewanella l...
Q8EFG0         232 VMLNQVQSMLGSIDEQHVLGLLKALTDADIGALMQSCAQVLAYGADAQEVLRSLLELLHQITLTQFAP-AAAQQ-----S 305  Shewanella o...
Q4FSV1         234 LDDVTVNSMLGLIDAADLVSLITDIYHHDKPAVAAHIEQMRAQMVDASSMFDGLAELLHQLALCQLLP---EVALN-VNE 309  Psychrobacte...
Q2NV61         232 VSAEAVSLMLGTLNTEQPLALIEALANADGGAMMAQLAQCAARGMDWESLLVEMLSLLHRLALCQLVPdQLNNED---DP 308  Sodalis glos...
WP_013299822   327 ADTERAQAMAHGVPLPALTRSWSLLMKALEEVQNAPDAAAAAEIGLIRVAYAAGQPTPEEALKAL 391  Parvularcula bermudensis
Q2GI84         317 SIITYIKN-EKILSPTFLSRLWQMLFKGIQEVKSSSCIKQAANMLIIRLCYLSSLPSPKQIIDKI 380  Ehrlichia chaffeensis str. ...
Q30UQ4         311 EEARQWLEWAPQFALSHIHACWQMTLEGQRRVLNSLEPAMALELLLLNLAF----MPRLLGMQQV 371  Desulfovibrio alaskensis G20
WP_011699634   310 DEKQLLAEAAGKTTPESLYLYFQTVLKSEEEIRRSTIPRIALEMLLLRLAR----LPRLESLQGV 370  Syntrophobacter fumaroxidans
Q6MH32         327 SELQALSEMAQRLPEEDIHMLFDMALKGGSDIPRAQDPRIVLEVTLLRMAS----APKLVDLKTL 387  Bdellovibrio bacteriovorus
jgi:Sama_1310  306 DNGAAVLAWAQALKPEQVQLYYQILLSGRKDLPYAPDPASGLEMSLLRAVG----FVPEKPVSRW 366  Shewanella amazonensis SB2B
jgi:Shew_2235  306 QYAEQIKAFAKQLRPEQVQLYYQLLLNGRQDLPHAPDPKSGLEMALLRAIA----FVPEAPVQRW 366  Shewanella loihica PV-4
Q8EFG0         306 LYSAQIQAFAEQLAPEQVQLYYQILLTGRKDLPHAPDPKSGLEMALLRAVA----FVPEKSVKRW 366  Shewanella oneidensis
Q4FSV1         310 AQAQHINQLAQHMSPDVLQLYYEIVVQAREGVKLASTPMQALEMCILRLLAFRPLP-VDEILVKV 373  Psychrobacter arcticus
Q2NV61         309 ASVARLRDLARRLPPADLQLYYQILLIGRKELPFAPDPRMGVEMTLLRALA----FHPAVVE--T 367  Sodalis glossinidius str. '...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap