5XVW


Conserved Protein Domain Family
Alfin

?
pfam12165: Alfin 
Click on image for an interactive view with Cn3D
Alfin
The Alfin family includes PHD finger protein Alfin1 and Alfin1-like proteins. Alfin1 is a histone-binding component that specifically recognizes H3 tails trimethylated on 'Lys-4' (H3K4me3), which marks transcription start sites of virtually all active genes.
Statistics
?
PSSM-Id: 403404
View PSSM: pfam12165
Aligned: 26 rows
Threshold Bit Score: 186.697
Threshold Setting Gi: 307107331
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5XVW_E         6 VEEIFKDYSARRAALLRALTKDVDDFYSQCDPEKENLCLYGHPNESWEVNLPAEEVPPELPEPALGINFARDGMQRKDWL 85  thale cress
XP_005845979   8 VDDVFADYAGRRRGIIKALSTEVDQLWEQCDPSKENLCLYGYSDGTWEVTLPCEEVPPELPEPTLGINFARDGMKRADWL 87  Chlorella varia...
XP_002946566   6 PRDIYEDYLGRRKAILRALTQDAEKFWHQCDPQKENLCLYGYNDGTWAVDLPAEEVPPEAPEPALGINFARDGMERSAWI 85  Volvox carteri ...
EFN55574       6 lqAIYDDYKMRREGLLLALIDDSKELWAACSPERDNMCLYGHSDGNWSVDLPVEEVPPELPEPVLGINFARDGMERKDWL 85  Chlorella varia...
XP_003579830  17 pDHVFRQYLGRRAGIVKALTEDVAEFYEQCDPEKAGLCLYGLPDGTWKVNFPVEKIPSILPEPVCGINFARDGTAKKDWI 96  stiff brome
XP_018674937  13 AEDLFKDFRGRRAGMIKALTTDFTKFYQQCDPEKDNLYLYAFADETWEVRERPEKVLTEFPELVIGINLARDVTEEKRWL 92  wild Malaysian ...
XP_009420260  15 IHMIFRDFLGKRAGLIKALTTDYEKFRQQCDPQKPYMCLYGCPDETWELKEPPD-VPHELPEPNIGINFARDGMPEKEWL 93  wild Malaysian ...
XP_009420358  13 VEEVFRDYLGRHRGLVRALTAEVDDLYALCHPERENLCLYGHPDGSWEVNVPPEEVPPEMPEPTLGINFARNGPKRWDWL 92  wild Malaysian ...
XP_001422648   7 VDEVHANFSRRRDGLVKALTRDVEAFYAQCDPDKENLCLYGNPDGTWDVQLPAEEVPPELPEPALGINFARDGMQRKDWL 86  Ostreococcus lu...
XP_015695910  17 IDDIFKDFIGRRTGIVRAFTEDLEAFTAQCKPDLDGLCLYGYANGTWEVAPPAQHVPTELPEPTVGINIPRDTMYKRDWV 96  malo sina
5XVW_E        86 SLVAVHSDCWLLSVSFYFGAR--LNRNERKRLFSLINDLPTLFDVVTG 131 thale cress
XP_005845979  88 CLVAVHADCWLMAMTFYNGAK--LDQKGRQRLFEEINSLPTVYEIVSG 133 Chlorella variabilis
XP_002946566  86 SLVAVHSDSWLLALAFYKGAR--LNREEREELFSLINKLPTCYEVVSG 131 Volvox carteri f. nagariensis
EFN55574      86 ALCAVHSDAWLMSLLFFYAAR--FDADGRAELFSLVNQHPTVYEVVTG 131 Chlorella variabilis
XP_003579830  97 SLIAVHSDAWLMSMAFYHAGRlaFDREARTELFRMINSFSTTFEVVRE 144 stiff brome
XP_018674937  93 ANVACHSDAWLLSFSLYWSLRfgFDKETRRQLFVMINTLPTISEVFLG 140 wild Malaysian banana
XP_009420260  94 GRIAIHSDAWLYSYAFYIAIRadLDAETRMRLFDMINFNPTIYEIVRG 141 wild Malaysian banana
XP_009420358  93 SRVAMHSDSWLLSVAFFFAAR--FSGDERKRLFNLINDLPTIFEAFCS 138 wild Malaysian banana
XP_001422648  87 ALVAVHSDAWLMAVAFYYGAK--FDAKKRDALFAQINAVPTVYETLSA 132 Ostreococcus lucimarinus CCE9901
XP_015695910  97 ALLTVFSDSWLLAVAFFHGARlnLDREGRVRLFDLINSVPTVYESVFG 144 malo sina
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap