Conserved Protein Domain Family
NADHdh-2_N

?
pfam12155: NADHdh-2_N 
NADH dehydrogenase subunit 2 N-terminal
This domain is found in eukaryotes, and is approximately 90 amino acids in length. It is found associated with pfam00361. All members are annotated as being NADH dehydrogenase subunit 2, and this region is the N-terminus.
Statistics
?
PSSM-Id: 152590
View PSSM: pfam12155
Aligned: 2 rows
Threshold Bit Score: 74.994
Threshold Setting Gi: 74829167
Created: 11-May-2020
Updated: 6-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q85PX3   9 MELTLGLIILIVLTYGLKAPTLRLAMLLAGAVgaagLLAEPHLLCWTQAIKMLVMLSGLALLCMLDHRTSHRSSSLLILL 88  Antillogorgia acerosa
Q564B0  10 MELTLGLIILIVLMYGLKAPTLRLATIYLGII----LLIGSQLLSCTQAIKMLVILSGLAVLCMLDHQISYRSSSLLILL 85  Erythropodium caribae...
Q85PX3  89 VILGNLLL 96  Antillogorgia acerosa
Q564B0  86 VILGNLLL 93  Erythropodium caribaeorum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap