Conserved Protein Domain Family
MFP2b

?
pfam12150: MFP2b 
Cytosolic motility protein
This domain family is found in eukaryotes, and is approximately 50 amino acids in length. These proteins are found in nematodes. They complex with MSP (major sperm protein) to allow motility. Their action is quite similar to the action of bacterial actin molecules.
Statistics
?
PSSM-Id: 403393
View PSSM: pfam12150
Aligned: 10 rows
Threshold Bit Score: 550.898
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_003141621   8 EDTWAFGPIGSPFPDNPVHALDQPNQYVALWYKHGKPIHGRAWNNGGVLECSFPYKNAELTGAKDLGGQIQILQYK---- 83  eye worm
EFO15477       8 EDIWAFGPIGSPFPDNPVRATGQQNMYVALWYKHGKPIHGRAWNNGGVIECSFPYNKAELTGAKDLGGQIQVLQYK---- 83  eye worm
XP_003139314   8 EDEWAFGPIGSPFPDNPVRVLGQPNMYVALWYKFGVPIHGRAWNNGGVLECSFPYKKAELTGTKDLGGQIQVLQYK---- 83  eye worm
2_pfamImport   1 DDIWTNQKVGTPFPTNVVKAPGETNKYVALWYRHGKPIMGRAWNDSGVMQCTFVLEDKVFTGS-DVGGVIQLLLLE---- 75 
XP_003117292   7 DDIWTFQKVGTPFPSNVAKAPGETNKYVALWYKHGKPVMGRAWNDSGVVKCTFVTDNKIYSGP-DVGGSIQLLVID---- 81  Caenorhabditis ...
Q94401         6 EDSWAFQPIGSPFPEAPVRVPNQNNQYVALWYKHGKPIHGRAWNNDGVVECSFPYNKAELKGKLDLGGQIQILQYK---- 81  Caenorhabditis ...
CRZ24696       6 EDTWAYNTIGSPFPDNPVRVKGQQNMYVALWYKFGKPIHGRAWNNNGNVECSFPYSKVELTGARDLGGQIQILTCSeqdp 85  Brugia malayi
NP_495864     14 DDIWTLQKVGTPFPPNVAKAPGETNKYVALWYKHGKPVMGRAWNDSGVVKCMFVLDDKIYSGA-DVGGSIQLLILD---- 88  Caenorhabditis ...
PDM67548       8 EDTWAFQPIGAPFPENPVKVLGQQNMYVALWYKHGKPIHGRAWNNGGVVECSFPYLKAELTGAKDLGGQIQVLQYK---- 83  Pristionchus pa...
NP_501838      8 EDTWAFQPIGAPFPPSPVKCMGEQNMYVALWYKHGKPIHGRSWNNGGVVECSFPYKEAELTTKQQLEGQIQVLQYL---- 83  Caenorhabditis ...
XP_003141621  84 -GDHNLLGFWYEWIKYKDRFE-KTEE-RQKLKCGDSLPILWKNRKAGPLMGYLD-ATELAHFSHDGKTEILQGTVLDDMY 159 eye worm
EFO15477      84 -GDHLTLGFWYNWIKYKDRFE-KFEKgAELLRCGDSFPIFWNDRNEGPLLGYVDnKTEIARFSHDGKVEEVSGGALNDML 161 eye worm
XP_003139314  84 -GDHNTLGFWYEWIKYKDRFE-KTDI-RQIVHCGDSMPILWQDRPEGALLGYLDnKTELAHFSHNGKAESLQGTPLSNMW 160 eye worm
2_pfamImport  76 -PPNKKKSFHYDWVSFKKAKSlTSEGkYEMVRCDYNSPVYWAEHG---FLGCINtQLQIAHFV-DNDSKILTTNKTEDLQ 150
XP_003117292  82 -PGEKPCPFHYDWVNYKKAQSlTIEGkYEMVRCEYSASVYWPEHG---LLGCVStNRLVAYFV-DNDSQIISTKKMDDLL 156 Caenorhabditis ...
Q94401        82 -GDYNSLGYWYEWLPLKQRHE-NNEGiREIVRCGNSVPVLAKLKDGTDKLGFLDlNTEVALFSNAGTTEKYEGGATANFM 159 Caenorhabditis ...
CRZ24696      86 vEQFKKSGFWYEWRPYKDR---ENDQlLQLVRCGQSTPVLMPTKDGNTFLGYIDmGKDVANVGYKGKNETLAGGEIQNLL 162 Brugia malayi
NP_495864     89 -HIEKSKSFHYDWVNFKKAQSlTIEGkYEMVRCEYSASMYWPEHG---LLGCVNtEKLVAHFV-DNEMQIKTTKKLEHLL 163 Caenorhabditis ...
PDM67548      84 -GDHRNLGYWYNWIKYSQRFD---GEhREILRCGDSIPLLWANRPQGAILGYVDnKTEIARFSHDGISEDKSGGELADMM 159 Pristionchus pa...
NP_501838     84 -GDHNNQGFWYEWIKYKDRIE-KIDDkHQLVRCGDSFPIFWK-RAEGNLLGYVDnKTEEAWFSFNGKVIKQLGPQLNEMY 160 Caenorhabditis ...
XP_003141621 160 IIVRNLKggppgceckkCyvppppppkpeepppppPPGPPPP--RIMRDEWMDLRMGDPWPT-RKLVQALGKTLDTIPKE 236 eye worm
EFO15477     162 IIVRELKggppncvcheC-----------------SAGPPKPvvRVTLDEWADFRYGDPWPTtGKPVQALNRALSTLSDE 224 eye worm
XP_003139314 161 IIVRNTKggpptcgckqCykpp---------ppkpPPGPPPP--RVMIDEWIDLRAGDPWPKdKKLIKALNKNLDTHPGE 229 eye worm
2_pfamImport 151 VL---------------Ckisg---------sresADKAAALnkMTNVNDWEDFNWGSYWPInKNVMSI---PKQL---G 200
XP_003117292 157 VL---------------CkiagakeahapekdkekSSVGYSLrlSTHINDWEDFNWGSPWPTnKNVMST---PKNISPVG 218 Caenorhabditis ...
Q94401       160 TIFRNLR-------------------------------PPPTglKVYDDLWYDLRYGDNFPS--NAVPADGRALNTETG- 205 Caenorhabditis ...
CRZ24696     163 VLFRNIK-------------------------------APPTgiKIYEDTWIDLKYRDPFPTaKNPIPGGGRKLKNDDGS 211 Brugia malayi
NP_495864    164 VL---------------Ckiagsrda--tekekekGSTGSASklLTVVNDWEDFNWGSAWPSnKNVMSI---PKNIPSAG 223 Caenorhabditis ...
PDM67548     160 IIVRELKggppncecpvC-----------------AKLPPKPviRVMLNEWADFRAGDPWPA-RKMVKALDKSLDTLAGE 221 Pristionchus pa...
NP_501838    161 IITRNCIggpphcpcavCg---------------aAPPPPKPvpRVERDEWMDIREGDPWPT-RQLVKALDKTLDTLPGV 224 Caenorhabditis ...
XP_003141621 237 DPDQYVALWYQQGEPIMGRIWkDSNGKVAAAFGWNGHEYR-DKVGSLQVLVELGHNVRGYDYSWQPFSVCGTFGEKEWLP 315 eye worm
EFO15477     225 NPNQYVALWYQSGEPVMGRIW-NDGGKIAACFGWGGHEYR-KNIGSIQVLFELPEQIRGFDYAWKPFKEAAQFGAKEWIP 302 eye worm
XP_003139314 230 NPEQYVALWYQQGEPVMGRIW-NNNGKVAACFGWNNNEYR-EKIGSLQILVELPDFVRGYDYDWKLFSVCASFGEKEWFP 307 eye worm
2_pfamImport 201 VPDQYVALWYRHGKPIMGRAW-PKNGKIDASFVDANREFTgPTVGSLQLLIALPPTTVGYDYVWMNYTLAMDYRDKDFVP 279
XP_003117292 219 F-DQFVALWYRHGKPIMGRAW-PKNGRIEASFVDSNREFTgATVGSLQLLISLPPTTVGYDYVWMAYGQAVDYRDKDYVP 296 Caenorhabditis ...
Q94401       206 PHMQYVALWYKHGDPVFGRSYpSSAGKTMAHFGKNNQENAgPEVGSMQLLTVPEASCMGLEYKWMPLSEGKSSG---WTT 282 Caenorhabditis ...
CRZ24696     212 ETYSYVALWYKHGEPVFGRAYpDPAGKTLASFGWNGQENAgAELGSMQMIVIPQPENLGFEYKWMSYKEVKG-GAGAFKP 290 Brugia malayi
NP_495864    224 I-DQFVALWYRHGKPIMGRAW-QSNGRIEASFVDAKREFTgATVGSLQLLISLPPTTVGYDYVWMTYTQAIDYRDKDYVP 301 Caenorhabditis ...
PDM67548     222 SPDQYVALWYQAGEPVMGRVW-NEGGKIAANFSWNGKEFK-TNIGSIQILFELSEHVRGFDYGWIPYQQAATFGEKEWHP 299 Pristionchus pa...
NP_501838    225 NPDQYVALWYMQGEPVMGRVW-NEGGKVAANFSWFNNEYC-KNVGSIQLLIYLPDSVRGFDYGWIPFPEAAQFGDKAWHP 302 Caenorhabditis ...
XP_003141621 316 VYVdy-kGIISPCVITWE-GKQILGKVDIRNEKASAAFSGKENIMIGPKVQ-SQLVLCRKAR 374 eye worm
EFO15477     303 VHVdhhkGNISPAVLIID-GKEILGKADIRNERATVGHGGTEKVYVGPAVH-TCVVLCRKAK 362 eye worm
XP_003139314 308 VYVdr-kGIISPCVCTID-GKEILGKVDIRNEKASAAFSGKEHVMVGPSVQ-KQMVLCRKAR 366 eye worm
2_pfamImport 280 VHL----SYVVPALVPVG-TKLLLGQVNMKTECATVAIDGKVTKLEGGPVK-SISVLCRREM 335
XP_003117292 297 VHL----SYICPAVVPVN-GKLILGQVNMKTECATVALDGTVTQLDGGPVK-SIFVLCRREM 352 Caenorhabditis remanei
Q94401       283 VHI----GNSAPCILKDDkGLEVLGNLDLTIEKASAGYGGKEKIMTGAAVA-KLKVLFKRRL 339 Caenorhabditis elegans
CRZ24696     291 LHV----GDCVPCVLKTAkGAELLGNLHMKMEKATAGFGGKDSAVVGPAVM-NFLVLCRNgh 347 Brugia malayi
NP_495864    302 VHL----SYICPAIVPVD-GKFFLGQVNMKTECATVALNGSVTQLDGGPVK-SIMVLCRKEM 357 Caenorhabditis elegans
PDM67548     300 VHVahhkGDISPAVIVID-GKQILGKVDIKNERACAGHGGKEVMHVAGAVH-SSVVLCRRAK 359 Pristionchus pacificus
NP_501838    303 VHVnnhkGDISVGVVNVAgGKQILAKVDVRNEKYGYGYQGKEHSATAKNCAdNTIVLCRKAK 364 Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap