Conserved Protein Domain Family
Med12-PQL

?
pfam12144: Med12-PQL 
Eukaryotic Mediator 12 catenin-binding domain
This domain is found in eukaryotes, and is typically between 325 and 354 amino acids in length. Both development and carcinogenesis are driven by signal transduction within the canonical Wnt/beta-catenin pathway through both programmed and unprogrammed changes in gene transcription. Beta-catenin physically and functionally targets this PQL (proline-, glutamine-, leucine-rich) region of the Med12 subunit of Mediator to activate transcription. The beta-catenin transactivation domain binds directly to isolated Med12 and intact Mediator both in vitro and in vivo, and Mediator is recruited to Wnt-responsive genes in a beta-catenin-dependent manner.
Statistics
?
PSSM-Id: 403387
View PSSM: pfam12144
Aligned: 12 rows
Threshold Bit Score: 184.266
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_005201865 1814 QVMHHPQSALWGYNlMGQPQQPGFFLQNQSVTPGGS---RLDPAgsFVptntkqaLSNMLQRRSGA--M-MQpps----- 1882 cattle
3_pfamImport    1 QMMHHHQSALWGYNvMGQPPQTGFFVQNQPVPPANPakvCPCLP--YK-------LSMWKMARSKTfaTtFFntl----- 66  
OCA24879     1699 DLLHTQAAG-MSRL-PYATQ--NMYAQNQPLPPGGP---RLDNS--YRptr--maMVKV-PARPQYv-SgVPqag----- 1760 tropical claw...
XP_008119976 1806 DLLHHQTANSMSRL-AYGQSPVGLYAQNQPLPAGGP---RLDTS--YRpvr-mpqIGKLVPSRPPY--TgVLpts----- 1871 green anole
XP_027692520 1798 DLLHHATGSSISRF-GYPQTPVTLYTQNQPLPAGGP---RLDTT--YRpvr--mpVPKL-QTRPSY--SgVLpsp----- 1861 common wombat
Q7YQK8       1666 DLLHHPNPGSITHL-NYRQGSIGLYTQNQPLPAGGP---RVD-P--YRpvr--lpMQKL-PTRPTY--PgVLptt----- 1728 chimpanzee
XP_005467433 1791 ELMQNPT---YARTmPYNPQ--NVYTQSQPLPPGGP---GLDAP--YRqpt-rnqIPKMMPARTNY--PtMMpgmpg--- 1854 Nile tilapia
TNN71273     1784 lmqnhP----YGRL-PYGQQTMGMYTQNQPLPPGGP---GLEPP--YRpvr-npqMNKMMPTRPSY--PgMMpnmqg--- 1847 Tanaka's snai...
XP_022527628 1719 ELMNMGQSGHTYRM-GYNQTSI-IYTQNQPLPPGGP---GLEPP--YRpr---mpVNKM-PTRPNY--PgNYhpg----- 1780 Mexican tetra
XP_031410947 1865 QMMQHPHSALWGYTiMGQPQQPGFFAQNQPLPPGGSr-lDPTSS--FVpantkqaLSNMLQRRSVLqpPsLH-------- 1933 turkey
XP_015207115 1806 EMLHGQQGHPFNRM-VYGPQSMGMYPQNQPLPPGGP---RLDTT--YRptr-------tlPMRPNR--PaAYpnmmtgmp 1870 spotted gar
XP_014349674 1818 DLLHHQPMHPYSRV-NYGQSSMGVYTQNQPLPAGGP---RLDAT--YRpsa--rvpMKI-SNRPPY--SgIMppvmp--- 1883 coelacanth
XP_005201865 1883 ---lhaITSQQ-QLIQMKLLQ-QQ----QQQRLLRQAQ-----TRPFQQGQpGDQaalfaaQ-ARP---------SPQLP 1938 cattle
3_pfamImport   67 ----csAQYLGtQIYKVFIFLkQGptidQAAIYSQQAR-----PSQLPQYP-GMQ------Q-AQG---------KHSMP 120 
OCA24879     1761 ----------mmDSYKPVMYR-PQppipQGQLLRQQLQ-----AKL-AQGMmPQ-------P-VRQ---------MSQTP 1806 tropical claw...
XP_008119976 1872 ---mssMMSID-QAYKSSVYRqQQppvpQGQLLRQQLQ-----AKLQGQGMvGPQ------P-LRQ---------MAPTP 1926 green anole
XP_027692520 1862 ---itgVISID-PSYKTPVYRqQQppvpQGQLLRQQLQ-----AKL-SQGMlGQP------P-VRQ---------MTPNS 1915 common wombat
Q7YQK8       1729 ---mtgVMGLEpSSYKTSVYRqQQpavpQGQRLRQQLQ-----AKIQSQGMlGQS------S-VHQ---------MTPSS 1784 chimpanzee
XP_005467433 1855 --smpgIMGPD-KPYQMT-FK-PHatmpQAPNLRQQLQvr--lHQ--NPNAlGQ---------IRQ---------MPPNQ 1907 Nile tilapia
TNN71273     1848 --smpgMMGMD-KQYPMG-YK-PQstmaQGQILRQHLQ-----VRL-NQSMiGQ-------Q-IRQ---------ITPNQ 1899 Tanaka's snai...
XP_022527628 1781 ---gmgIMGMDnKQYTMG-FK-PQtamsQGQMLRQQIQvrlnqSML------GQ-------Q-MRP---------MAPNQ 1832 Mexican tetra
XP_031410947 1934 ------AVTPQqQLLQMKLLQqEQ----QQRLLRHQAQ-----ARSLQQDVsSSA------VsLQDgfdnimgqpMDPAA 1992 turkey
XP_015207115 1871 ggvgnlITALDqQAYRA--YK-PQpp-iQGQILRQQLQ-----AKL-SQGMlGQ-------Q-VRQ---------MPPNP 1923 spotted gar
XP_014349674 1884 --giggIMSLDqQSYKQGGYR-PQpppsQGQLLRQQLV-----AKLQNQAMgSH----------RQ---------MNPTS 1936 coelacanth
XP_005201865 1939 QY---------------PGLQqa-qtMP----QGYTMYGTQMPLQQTpq-qQAGSVVlSPTYNSRTYPAAH--SNPALME 1995 cattle
3_pfamImport  121 IY---------------TEIAl---aIP----HGYTMYSTQMSLQSQ----QSGGLVlSPAYSPRAYQVAH--SNPALME 172 
OCA24879     1807 SY---------------GSMQ------P----QGYTSYGSHMTLQQHpppsQAGALV-PPPYSTQQYPGSLppSGGALLD 1860 tropical claw...
XP_008119976 1927 SY---------------GAVQ-----PS----QGYTPYVSHIGLQQHp--sQSGAMV-PPSYSSQTYQNAHpgSNPTFVD 1979 green anole
XP_027692520 1916 SY---------------GSLQ-----AS----QGYTPYGSHIGLQQHt--gPAGTMV-PPSYSSQPYQSPHpaANPTLVD 1968 common wombat
Q7YQK8       1785 SY---------------G-LQ-----TS----QGYTPYVSHVGLQQHt--gPAGTMV-PPSYSSQPYQSTHpsTNPTLVD 1836 chimpanzee
XP_005467433 1908 QY---------------TSMQt---------sQGYTTYGSHMGMQQHp--sQSGSIV-PHSYGNQNFPGAHpgANPAVVD 1960 Nile tilapia
TNN71273     1900 PY---------------TSMQas-qnIS----QGYTTYGSHMGMQQHp--sQGGGIV-PSSYGNQNFQGTHpgANPAVVD 1956 Tanaka's snai...
XP_022527628 1833 QY---------------SSMQpaqniSQ----QGYTSYGSHMVMQPHp--sQTGAIV-PSQYGNQAFQGAHpgTNPGVVD 1890 Mexican tetra
XP_031410947 1993 LFtpqvrptpqlpqypgLQQAq---gMP----HGYTMYSTPMPLQQQ----QPGSVVlSPGYTPRAY-TAH--SSPVLME 2058 turkey
XP_015207115 1924 SY---------------GTLQp---------tQGYTSYGPHMGMQQHp--sQTGGMV-PPAYANQPFQGSHpaPNPAMVD 1976 spotted gar
XP_014349674 1937 SY---------------GSLQ-----APqnmsQGYTPYGSHLGLQQQl--pQAAGMV-LPTYSGQAFp----gSNPALID 1989 coelacanth
XP_005201865 1996 RLRQMQQPPSGYVQQQAS-PYLHPLTGSQRLNHQSLQ 2031 cattle
3_pfamImport  173 RLRQIQQQPSGYIHQQAA-AYLQPLTGNQRLSHQALQ 208 
OCA24879     1861 PVRQMQQRPSGYVHQQAS-GFSHSASAGQRFPHQQIT 1896 tropical clawed frog
XP_008119976 1980 PTRTM-QRPSGYVHQQAP-GYVHSLSAAQRFPHQSMQ 2014 green anole
XP_027692520 1969 PARHLQQRPSGYVHQQAP-GYGHGLPTTQRFAHQSLQ 2004 common wombat
Q7YQK8       1837 PTRHLQQRPSGYVHQQAP-TYGHGLTSTQRFSHQTLQ 1872 chimpanzee
XP_005467433 1961 PLRQ--QRPSGYLLQQAP-GYPQSMQNTQRFPHQQLQ 1994 Nile tilapia
TNN71273     1957 PLRQMQQRPSGYVHQQAP-GYAHNMQNSQRFAHQPLQ 1992 Tanaka's snailfish
XP_022527628 1891 PLRQM-PRPSGYVHQQASsAYG--MQNTQRFAHQPMQ 1924 Mexican tetra
XP_031410947 2059 RLRPGQ--PGGVAQQQAA-AYMQPLTGAQRLTHQPLQ 2092 turkey
XP_015207115 1977 SLRQMQQRPSGYIHQQAP-GYVHAMQNTPRFAHQQAS 2012 spotted gar
XP_014349674 1990 SVRQIQQRPSGYVHQQAP-GYSHSLQNPQRFTHQPMQ 2025 coelacanth
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap