Conserved Protein Domain Family
DUF3583

?
pfam12126: DUF3583 
Protein of unknown function (DUF3583)
This domain is found in eukaryotes, and is typically between 302 and 338 amino acids in length. It is found in association with pfam00097 and pfam00643. Most members are promyelocytic leukemia proteins, and this family lies towards the C-terminus.
Statistics
?
PSSM-Id: 403373
View PSSM: pfam12126
Aligned: 16 rows
Threshold Bit Score: 415.369
Threshold Setting Gi: 611964578
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_008764653 293 LGTMTQALEEQGRTFDSAHAQMHSAIGQLDDARSDTEKQIRARVRQVIEHVQAQERELLEAVNVRYQRDYQEIAGQLGHL 372  Norway rat
XP_002723888 237 LDATARALRERGGAFGAALAQVRAAIGQLGRARADAEDLIRERVRQVVAHVQAQERELLQQVHACYQRDYEELAARLSRL 316  rabbit
XP_018865808 240 LDAMTQALQEQDSAFGAVHAQMHAAVGQLGRARAETEELIRERVRQVVAHVRAQERELLEAVDARYQRDYEEMASRLGRL 319  western lowlan...
ELW62488     217 LDGMTHALREQDGAFGAAHAQVHAAIDQLDQARRDTEELIRQGVRQLLAHVQAQERELLQAVEARYHRDRRELDSRMGRL 296  Chinese tree s...
XP_012657399 215 LDSMTQGLQEQDSAFGEVHAQMSAVVSQLGHRRSEMEALIRERVREVVKHVEAQERNLLEAVKERYERDYEEMARQLGSL 294  small-eared ga...
XP_003462251 239 LDAMARALQEQEGAFQSVHTQVRSAISQLGHAREDTEEQIRAQVRQVVAHVQARERELLEAVQARYQRDYEGMAGRLGRL 318  domestic guine...
EHB11870     239 LDAMARSLQDQDGAFQAVRAEVRSAVSQLGQARADTEEKIHAHVRQVIAHVQARERELLQAVQAQYQRDYEGMARRLGRL 318  naked mole-rat
XP_005316841 239 LDTMAHALQEQDSTFSTAHAEMRSAIGQLGRARADTEELISTHVRQVVAHVLARERELLDAVNEQYQRDYQEMASQLRRL 318  thirteen-lined...
EGW02110     191 LGTMTQALQEQDKTFDNAHAQMRSAIGQLEQARADTEELIRARVRQVVEHVQAQERELLEAVNARFQRDYQEISGQLGRL 270  Chinese hamster
NP_001298017 244 LGTMTQTLEEQGRTFDSAHAQMCSAIGQLDHARADIEKQIRARVRQVVDYVQAQERELLEAVNDRYQRDYQEIAGQLSCL 323  house mouse
XP_008764653 373 EAVLQRIRTGGALVKRMKLYASEQEVLDMHGFLRKALCRLRQEEPQNHKVQLRTSGFEEFKLCLQDLVSFITQRTDVAVA 452  Norway rat
XP_002723888 317 EAVLQRMRTGGALVRRMKHYASDQEVLDMHGFLHEALCRLRQEEPQGPQAAVRAEGFDEFKVRLQDLVARVTQATDAILS 396  rabbit
XP_018865808 320 DAVLQRIRTGSALVQRMKCYASDQEVLDMHGFLRQALCRLRQEEPQSLQAAVRTDGFDEFKVRLQDLSSCITQGKDAAVS 399  western lowlan...
ELW62488     297 DTVLQRIRTGSTLVERMKRYASDQEVLDMHSFLRQALCSLRQEEPQSLQAPVCTDGFKEFKARLQSLSSCVMEGKDAAPS 376  Chinese tree s...
XP_012657399 295 NTKLQRIRMGGMLVQKMRRFASDQEVMDMHGFLREALRRLCQEQPQTPQATVHTDSFDEFRARLEVLTSSITQGTDAVLC 374  small-eared ga...
XP_003462251 319 DAVLQRIRVGGTLVQRMKSYASDQEMLDMHGFLREALCRLRQEEPQHLQAPVRTDSFDEIKVRLQDLISCIPQGTDTSLS 398  domestic guine...
EHB11870     319 DAVLQRIRVGGTLVQRMKRYASDQEMLEMHGFLREALCRLRQEEPQHLQAPVRTDSFDEVKVRLQDLMSCIPQGTDAALS 398  naked mole-rat
XP_005316841 319 DAVLQRIRTGGALVQRMKRYASDQEVLDMHDFVHKALNRLRQEEPQSLQAALHTDGFEEFKIRLQDFISCITQGTDAAVC 398  thirteen-lined...
EGW02110     271 EAVLQRIRTGGELVKRMKLYASDQEVLDMHSFLHKALCRLRQEEPQNQKVQLRTSGFEEFKTCLQDFMSCITQRTDEAVA 350  Chinese hamster
NP_001298017 324 EAVLQRIRTSGALVKRMKLYASDQEVLDMHSFLRKALCSLRQEEPQNQKVQLLTRGFEEFKLCLQDFISCITQRINAAVA 403  house mouse
XP_008764653 453 GraspeaasthpeaasaqpeaasthpeaasaqpeaaSAHPESASTPGNSTDLEQPKEV-QRA--QAQamel----sktqP 525  Norway rat
XP_002723888 397 R-----------------------------------RTSPQSASTPGDLLHVDLPEQA-QKM--QAP------------P 426  rabbit
XP_018865808 400 K-----------------------------------KASPEAASTPRDPIDVDLPEEA-ERV--KAQvqalg--laeaqP 439  western lowlan...
ELW62488     377 R-----------------------------------RASPEAASTPRDPIDIDPPEKV-QRV--QAQgqgp----aeaqS 414  Chinese tree s...
XP_012657399 375 N-----------------------------------RASPL-----RDASDDDLPEEVpQRVqmQAQaeatalelaenqC 414  small-eared ga...
XP_003462251 399 R-----------------------------------RVISEASGTPSDSSVSDQPSEA-QKA--QALalgl----setqP 436  domestic guine...
EHB11870     399 K-----------------------------------TASPEASSTPNDSSVTDQSNKA-PKA--QAQplgl----seaqP 436  naked mole-rat
XP_005316841 399 R-----------------------------------RASPETAGTPREPFDVDLPDEA-QRV--QAQalgl----aeaqP 436  thirteen-lined...
EGW02110     351 R-----------------------------------RASPQPASTPRESSDLEQPNEV-QRE--LAQalnm----sethS 388  Chinese hamster
NP_001298017 404 Speaasn------------------------qpeaaSTHPVTTSTP---EDLEQPKEV-QSV--QAQalel----sktqP 449  house mouse
XP_008764653 526 VAMVKSVPGAHPVPVYAFSMQGPTYREEASQTVSPMKRKCCHIDCCRKIIKMESTDENedRLSTSSPEQPRPSTSKAISP 605  Norway rat
XP_002723888 427 MAVVQSVPGAHPVPLYVFSIRDTSSAEEDSGTLVGRKRKSCYTQCPQKMIKLESEEKE--RPAQSSPEQPRPSTSKAVSP 504  rabbit
XP_018865808 440 MAVVQSVPGAHPVPVYAFSIKGPSYGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKeaRLARSSPEQPRPSTSKAVSP 519  western lowlan...
ELW62488     415 VAVVQPVPGAHPVPVFAFSIKEPSCG-EISHTTTSQKRKSCQTQSPRKVIKMESEEEReaRLARSPSVQPRPSTSKAVSP 493  Chinese tree s...
XP_012657399 415 MAVVQSVPGAHPKPMYAYSIKDSSYREEIPKIAVPQKRKSCQTECPRKVIKMESEEDKeaKLALNSSEQPRPSTSRAVSP 494  small-eared ga...
XP_003462251 437 AQMVQMVPRAYPVPIYAFSIRSPSSG-EVSSAASPTKRKSCHTQCSRKIIKLESEEDTelPLAPSPSEQPRPSTSRAVSP 515  domestic guine...
EHB11870     437 AAVVHLVPRAHPMPIYAFSMRSPPSG-EVSNIVSPQKRKSSQTQCSRKIIKLESEEGKevPMAPRPTEQPRPSTSRAVSP 515  naked mole-rat
XP_005316841 437 VAVVQSVPGAHPVPLYAFSIKGSSYSEEVSNTTTPQKRKSCHTQCSRKVIKLESEEDKeaRLASSSPEQARPSTSKAVSP 516  thirteen-lined...
EGW02110     389 VAVVQSVPGAQPVPVYAFSMKSPTYREEASQTVTPRKRKCCHRNCSGKIIKVESTEENedRLSTSSPEQPRPSTSKAISP 468  Chinese hamster
NP_001298017 450 VAMVKTVPGAHPVPVYAFSMQGPTYREEASQTVGSMKRKCSHEDCSRKIIKMESTEENedRLATSSPEQSWPSTFKATSP 529  house mouse
XP_008764653 606 PHPDGTSST-ESTIPEKETPLPNNNHVAS-DAGETEERIVVISSSEDSDaenL 656  Norway rat
XP_002723888 505 PQLDGTPSP-GSPNVGEEVDPANSNHVAGdDPEEAEERVVVISSSEDSD---D 553  rabbit
XP_018865808 520 PHLDGPPSP-RSPVIGSEVFLPNSNHVAS-GAGEAEERVVVISSSEDSDaenS 570  western lowland gorilla
ELW62488     494 FRLDGPTSP-GHPTVGDEVSLPSSNHLAStAGEEAEERIVVISSSEDSDvdnP 545  Chinese tree shrew
XP_012657399 495 PHLDGLPSP-KTPIKEADISSLNSSHGTD-DIEEAENCVFVISSSEDSDaehS 545  small-eared galago
XP_003462251 516 PHLDRPAQP-ESPTMGKEALQLNSTHVAT----EADEPIVVISSSEDSDaenS 563  domestic guinea pig
EHB11870     516 PHPDGPTQP-ESPTVGKEVLQPNSTPVIS-GAAEADERIVVISSSEDSDaenS 566  naked mole-rat
XP_005316841 517 PHSDGPPSP-ESPIIGKEVLLPNNNHVLG-DTGEAEERIVVISSSEDSDaenS 567  thirteen-lined ground squirrel
EGW02110     469 RHVDGPANTdESPVLEEDTLLLTSNLVTS-DTGEAEEPIVVISSSEDSDtenL 520  Chinese hamster
NP_001298017 530 PHLDGTSNP-ESTVPEKKILLPNNNHVTS-DTGETEERVVVISSSEDSDtenL 580  house mouse
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap