Conserved Protein Domain Family
DUF3575

?
pfam12099: DUF3575 
Protein of unknown function (DUF3575)
This family of proteins are functionally uncharacterized. This family is only found in bacteria. Proteins in this family are typically between 187 to 236 amino acids in length.
Statistics
?
PSSM-Id: 403354
View PSSM: pfam12099
Aligned: 68 rows
Threshold Bit Score: 138.867
Threshold Setting Gi: 524338102
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_005834291   8 YVFWLLLFCMMSGQviGqnksveShshtcktvLALKNNLLYDLA-LAPNIEVELPLGKRWSLNVE--YkCPWWS----DS 80  Bacteroides
Q5L7P5         4 krSVFLFLLVVSSTflGveiargQv-------YSLQTNVLGWGT-TNMNLEFGLKFSHRWTFHFPlqY-NPFSFg---DA 71  Bacteroides fra...
CDD82477       8 LVSLLLLPWTVSA----------Qf-------YSLRTNVAALAT-GNLNAEFSMTLNRKWSVHLPlqY-CPFKFn---AN 65  Bacteroides sp....
wustl:BV0892  10 CAGLLAFFLSVSA----------Qs-------YSLRTNVIGLAT-TNLNLEASMTLNRKWSLHLPvqY-NPFKFg---RN 67  Bacteroides vul...
Q5LFB2         8 LGSLLAFTLGVSA----------Qs-------YSLRTNVLGLAT-TNLNLEASMTLGRKWSLHLPvqY-NPFRFs---KN 65  Bacteroides fra...
WP_022545817   4 MVILILIVFISYTHcpA------Qk-------FGVGTDVISLTT-ATLNVEASVMVSKKVTLQLPlsW-NPFTMk---NN 65  Bacteroidales b...
CCY34450      10 IAALLLTFS---FPswG------Qr-------WSIATNLLDYADfITLNVEVGASVHQHWTVSVKgrY-NPFSFptrlNE 72  Alistipes sp. C...
CDA96452      12 ITVLMLFPC----McrA------Qk-------WSLGTNAVDWLWlGTMNASGSVAVDRHFSVNAEarV-NPWTFns-dDP 72  Bacteroides sp....
CDA92840      16 VVAAVGFLC-GSTNlnA------Qk-------ASLSTDLLGYANfVTMNLDASYPVSRHWSINAGvrY-NPFTFdl-gEG 79  Bacteroides sp....
CDC65323      18 MLAAFFGFCs-----rA------Qk-------AALATDLVSYVNfVTLNAEVSYPVARHWSVNAGfrY-NPFTFnl-gEG 77  Bacteroides sp....
WP_005834291  81 GcnfCYQLLSGGTEARYWLgnrhtRGRLSGH-FLGAYAEGGTYDFQ---LKKeKGYRGkYYAAAGITYGYVRPLARHLAI 156 Bacteroides
Q5L7P5        72 R----LRNLSASPGVRYWI-----RESYGRSyFLGIHGVSTMYNVGgvfGDK-YRYEG-YGFGGGLSLGYNRPLSPHWNL 140 Bacteroides fra...
CDD82477      66 R---QWRNIYTSPGVRYWL-----RESYTGG-FIGLHGVAAVYSVGglfGNK-FRYEG-EGYGAGLSIGHAYALAKRWNL 134 Bacteroides sp....
wustl:BV0892  68 R---QFRNFYAAPGVRYWL-----LESYMGG-FIGMYGTAGTYSVGnlfGNK-YRYEG-EGYGVGLSIGKAYQIGRRWNL 136 Bacteroides vul...
Q5LFB2        66 R---QFRNLYVAPGVRYWL-----LESYMGP-FIGMHGTAGTYSVGnlfGSR-YRYEG-EGYGVGVSIGKAYQLSTHWNV 134 Bacteroides fra...
WP_022545817  66 F---KIKHIAIQPGIRWWF-----WHGYSEF-YLGAHLLTSIFNIA---VSN-QRKQG-WASGISFTCGYAWMLNQHVNL 131 Bacteroidales b...
CCY34450      73 AgriQNRTGSVAAGFKYWP-----FFVYSGF-YYGGRVQWSRYNSGg-iFSP-ASEEG-DALGLGVNFGYSLLLTKHLNI 143 Alistipes sp. C...
CDA96452      73 SkqmQDRRQTYSAGFRWWP-----WYVYSGW-WAGLSAQYGEYSRGg-iVSR-STEEG-DAYGAVLAGGYSLMLHRNLNL 143 Bacteroides sp....
CDA92840      80 KedaRNRQQTYLAGVRWWP-----WNVYSGW-WLGGKMQYQEYNTGg-iFSR-KTREG-DRYGAGVAGGYSYMLGRHLNL 150 Bacteroides sp....
CDC65323      78 KedvRNKQQSYSAGVRFWP-----WNVFSGW-WLAGKVQYQEYNSGg-lVSR-KTYEG-DRYGAGFSGGYSYMVGKHFNI 148 Bacteroides sp....
WP_005834291 157 EFSVGIGYLDTEYRKYTSYGnDLVWVSSGKYHFIGPTKAKISLVWLL 203 Bacteroides
Q5L7P5       141 EFEAGLGVLWTHYDKYVCKA-CGQKVATFKGARLIPTKLAVNIVYLF 186 Bacteroides fragilis NCTC 9343
CDD82477     135 EWELGGGPVWLAYDKYACRH-CGGWKARESGWYLLPTKLAFNVVYLF 180 Bacteroides sp. CAG:462
wustl:BV0892 137 EWEAGAGAVWLAYDKYLCKR-CGDLVGQEYGWHFLPTRAALNVVYLF 182 Bacteroides vulgatus ATCC 8482
Q5LFB2       135 EWEVGTGAVWLGHDKYLCKR-CGDLVSKNYGWHFLPTRAAVNLVYLF 180 Bacteroides fragilis NCTC 9343
WP_022545817 132 EIEAGGGPIYREYDKFESET-CGEYLGTTKGVILFPTRLSCSVFFLF 177 Bacteroidales bacterium CF
CCY34450     144 EFGIGLWFGGTSYRQYGTTA-CGKLLDHGIKAFAAPNDVQINLLYTF 189 Alistipes sp. CAG:831
CDA96452     144 EFGAAFWTGRTDYTTYACPK-CGRITGSGTKWFILPSSVMSSLVWVF 189 Bacteroides sp. CAG:709
CDA92840     151 DFGIGLWGGMDKYSVYECPV-CGVTSSSGAKFFILPSDIMVALSYVF 196 Bacteroides sp. CAG:709
CDC65323     149 DFGLGFWSGMDVYKKYSCPV-CGVTEDTGSKFFFLPSDVIIALSYVF 194 Bacteroides sp. CAG:770
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap