2KRX


Conserved Protein Domain Family
CRR7

?
pfam12095: CRR7 
Click on image for an interactive view with Cn3D
Protein CHLORORESPIRATORY REDUCTION 7
This entry includes protein from blue-green algae and plants, including CRR7 protein from Arabidopsis. CRR7 is part of the chloroplastic NAD(P)H dehydrogenase complex (NDH Complex) involved in respiration, photosystem I (PSI) cyclic electron transport and CO2 uptake. It is essential for the stable formation of the NDH Complex.
Statistics
?
PSSM-Id: 403351
View PSSM: pfam12095
Aligned: 56 rows
Threshold Bit Score: 99.8733
Threshold Setting Gi: 147849699
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2KRX_A           7 YQQDNFVVLETNQPEQFLTTIELLEKLKGELEKiSFSDLPLELQKLDSLPAQAQHLIDTSCELDVG-AGKYLQWYAVRLE 85  Nostoc sp. PC...
Q9FL87          77 SNSDTYVLLEAGQDEQFVTEDELKAKLRGWLENwPVNSLPPDLARFDDLDEAVDFLVKAVCELEIDgEVGSVQWYQVRLE 156 thale cress
Q31LS3           7 YQEDAYVLLEPNCPERFVTPAEMLAYLEELIDR-YPDNVPVGTADRGDRRAQAQDLLNTACEFETE-PGLVVQWYVVRLE 84  Synechococcus...
CAK27193        15 RELDHYVVLDPAVGEQILSAAETRHWLAEQLQR--LKQLPADIAAVEGLPQQVEWLIDTACALEIE-PGLTVQWFAVRLE 91  Synechococcus...
Q7VE84           7 RDNENYVVMEPCKNEKLLTSKETLQWLENWLNQ--MDELPEDLKEHPSNVEAAQRLLDTACDLEIT-PGFNIQWFAVRLN 83  Prochlorococc...
WP_011294109     7 REMDNYVVLVPGESEQFLDKEQTLLWLQSWLNK--FDSLPLDLDCKSSIAEAAQHLLDTACDLEIK-TGFTIQWYAVRLE 83  Prochlorococc...
Q7V4J1           7 RDSDHYVVLEPGQSERLLSAADTLVWLQTWLQS--LDVLPEDLQSQNSLVAAAQRLLDTACELEVG-QGLCLQWFAVRLE 83  Prochlorococc...
CAK24640         7 RSLDHYVVLVPGESEQLLTAAATLTWLTERLTA--LNPWPEDLRGCDGASEAAERLLDTACELETS-PGVCVQWYAVRLE 83  Synechococcus...
jgi:Cyagr_2951  15 RELDHYVVLEPGKGESILSAAETLHWLAGHLAA--LAEPPADLADLADPEARAGRLLDTACELELA-PGCAIQWFAVRLE 91  Cyanobium gra...
XP_002993783     3 EDEDTFVLLEPGEDEVFVSMEQLQSRIKSWLERwPSGSLPFDLQNFKTLDEAASHLVTNSCELEIGgGFGSIQWFQVRLE 82  Selaginella m...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap