Conserved Protein Domain Family
DUF3561

?
pfam12084: DUF3561 
Protein of unknown function (DUF3561)
This family of proteins is functionally uncharacterized. This protein is found in bacteria. Proteins in this family are about 110 amino acids in length.
Statistics
?
PSSM-Id: 403344
View PSSM: pfam12084
Aligned: 11 rows
Threshold Bit Score: 127.84
Threshold Setting Gi: 123520027
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6D1A8         5 MQNATQLTISKTRPAqEEDDGVSYLFMGAVTGFSFYWLAFSIPFLVYGSNTTfFFMLYTWPFFLALMPFSVLVGVGFSFL 84  Pectobacterium ...
WP_002442455   1 MRNGSNLFLSRAYGP-QTDDETAWSLSGGIMGFIAWLLALALPFAVYGSNTL-FFFLYTWPFFLALMPVAVVVGVAMHSL 78  Shimwellia blattae
WP_002915157   1 MRNTQNLSIIRSEPPpAIGDETTWSLSGAAVGFISWLLALGIPFLLYGSNTL-FFLLYTWPFFLALMPVAVVVGIALHSL 79  Enterobacteriaceae
P46141         1 MRNSHNITLTNNDSL-TEDEETTWSLPGAVVGFISWLFALAMPMLIYGSNTL-FFFIYTWPFFLALMPVAVVVGIALHSL 78  Escherichia col...
Q7CPW6        12 MRNSHNITFTRSDAF-MVDDDATSAFPGAVVGFVSWLLALGIPFLLYGPNTL-FFFLYTWPFFLALMPVSVIIGIALHLL 89  Salmonella ente...
WP_012134865   1 MRNSHNITITRSDAL-TTDDDTTWSLPGAVVGFASWLLALGIPFLIYGPNTL-FFFLYTWPFFLALMPVAVVVGVALHSI 78  Citrobacter
WP_013203545   1 MHNVTPM---LARKDdRDQEDPSWSFPGGVVGFASYWLALAIPFVMYGANTL-FFFLYTWPFFLALLPVSVLVGIVANVL 76  Erwinia billingiae
WP_013026921   1 MQNITPM---LARKDhRTPDEPRSVLPGGVIGFICYWCALAIPFLLYGSSTL-FFFLYTWPFFLALFPVSVLTGMVLNTW 76  Pantoea
CAL21952       1 MQNVTQI---MNDEQ-QEEEEPSYSFSGGVTGFVFYWLAFAIPFFVYGPNTV-FFLLYTWPFFLALMPVSVLIGIALGML 75  Yersinia pestis...
Q2NVM6         8 ikRAIPFKFSLALDRkFRRDEPPYALWGGIAGFVFYWLAFAVPILQFGANAL-FFLLYTWPFFLALLPVCVLMGVIYSVL 86  Sodalis glossin...
AHG21273       1 mQNITPT---LADAQ-QAPEEPTYFFLGGVSGFAFYWLAFAVPFLAYGSNTL-FFLLYTWPLFLALMPVSVLIGITVSMW 75  Chania multitud...
Q6D1A8        85 LRGYLFYTLFATGLTVVCLFWMVFSFLTG 113 Pectobacterium atrosepticum
WP_002442455  79 LAQRMLYSGAATLVTVAVMFGILFLWLPG 107 Shimwellia blattae
WP_002915157  80 LNGKLLYSVSATILTVGLMFALLFLWLLG 108 Enterobacteriaceae
P46141        79 MDGKLRYSIVFTLVTVGIMFGALFMWLLG 107 Escherichia coli K-12
Q7CPW6        90 VKGKILFSIMFTLLAVGALFGALFIWLLG 118 Salmonella enterica subsp. enterica serovar Typhimurium
WP_012134865  79 MSGKLFYSITATLLTVGAMFGALFMWLLG 107 Citrobacter
WP_013203545  77 LRGQLIWTILLTAVVVVCLFWLLFTLLTG 105 Erwinia billingiae
WP_013026921  77 LRGQLLWTVLICVAAVACQFWLLFLFLSr 105 Pantoea
CAL21952      76 SRGHLLFTIGGTGIAVVCLFWMLFSLLTG 104 Yersinia pestis CO92
Q2NVM6        87 LGGRVCLSLLATGLSVFSLFWLVFIFLSG 115 Sodalis glossinidius str. 'morsitans'
AHG21273      76 LRSKLFLSLGITGAAVIGLFWLVFQWLSG 104 Chania multitudinisentens RB-25
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap