Conserved Protein Domain Family
DUF3560

?
pfam12083: DUF3560 
Domain of unknown function (DUF3560)
This presumed domain is functionally uncharacterized. This domain is found in bacteria. This domain is about 120 amino acids in length. This domain has a conserved GHHSE sequence motif.
Statistics
?
PSSM-Id: 403343
View PSSM: pfam12083
Aligned: 22 rows
Threshold Bit Score: 83.9118
Threshold Setting Gi: 521299874
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAL01877                90 QRTERAENRADCFETYASNAENRAEALQKPLNDRHGDIAFfTQPIIPGHSGSQSFARYREKLFARYERGFEEYRKSDYFK 169 Oscil...
WP_012735314            71 SLSERAEARAERYAAASDRAEAQAQARRAAVDAIAEHIPL-GQPILVGHHSEGRHRRDLARMDASIRQALTLWDKSEYWQ 149 Burkh...
jgi:Ajs_4206            71 SLVERAEERADRFEDYSDKRADDAAAARNAVQAIGQRFEF-GQPILVGHHSERKARKDAERMENGMRRAVQMWETSEYWK 149 Acido...
WP_011733773            71 SLVDRAEQRAERFEDYSDRRAGDSQKATAHVKSIADGIPF-GQPILVGHHSEKHARKHAEQIENGMRKAVKMWDQAKYWT 149 Pelob...
PRJNA231235:Y013_25670  86 DKIARQAARVDALDAKAARKAGTAEAAWAADQAAHDALPEgGEPIKVGHHSETRHRRAVEKSWNALGKAVAAEREAATAR 165 Rhodo...
Q0RWY8                  87 DRIERQAGRVAALEDKAQRRADQADQAWEADRRAHDALPEgGEPIHVGHHSERRHRRAIETAHRTLEQAVAAEEDAKAAR 166 Rhodo...
Q9PHE6                  24 SYEAKQTARKARFEKYASEAAAESVSTYQRARSMGESIPF-GQPILIGHHSEQRDRNFRDRIHNTYKKAFALHDKANHYA 102 Xylel...
CAP44115                 3 HYEAKQADRKARLEARAVQAEAQAATTYDRAKQMGEAIPF-GQPILVGHHSEGRDRNYRQRIHSTYGKAFDLQKKADHYV 81  Borde...
mmlSJTU:SCATT_06080    152 DRVARSAARAERFQGYAGNAADRSAAAHATARRIADGIPL-GQPILLGHHSQRRAERDRDRIWSNTEKGVKEADKAEYLA 230 Strep...
Q0RM40                  90 gRTLDAQDRAQRYDGYARSATSRADSREAAADRVLGGIPP-GQPMLVDHYSYAADKRRRERAWSNQDRAAEERDKAQYWQ 168 Frank...
BAL01877               170 SRAETARITASmeKLNDKGYLDRRIKECRKEIRSREKNILQ 210 Oscillibacter valericigenes Sjm18-20
WP_012735314           150 RRARAAIANAQ--YKERPDVRHRRIKRLEADLRARQRSKLD 188 Burkholderia glumae
jgi:Ajs_4206           150 QRAAGALRHAK--YKELPAVRHRRIKGLEADKRKQERSKQE 188 Acidovorax sp. JS42
WP_011733773           150 SRAAGALSHAK--YKERPDVRARRIKTIEADKRKQERTRKE 188 Pelobacter propionicus
PRJNA231235:Y013_25670 166 GRVDAAAKTTD--RRYAPVTVARRIDKLTAELRRLERDRDG 204 Rhodococcus pyridinivorans SB3094
Q0RWY8                 167 RRAESAAVTTS--ARYNPETVKNRIDALQASQRADQRLWDG 205 Rhodococcus jostii RHA1
Q9PHE6                 103 DKAASVGTGGi--SSDDPDAIEKLRAELANIEASRERMKEA 141 Xylella fastidiosa
CAP44115                82 QKAAAVGDGGv--SSDDPDAISKLMRQVEQLTENQERMKKS 120 Bordetella petrii
mmlSJTU:SCATT_06080    231 RRAAASASYEE--FRKNPGVTLRRIAKLEADLRRVHRQIAA 269 Streptomyces cattleya NRRL 8057 = DSM 46488
Q0RM40                 169 ARQRAAERWPT--SRTNLDAMLRRVQWIEADMRRTRRRLAE 207 Frankia alni ACN14a
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap