Conserved Protein Domain Family
DUF3556

?
pfam12077: DUF3556 
Transmembrane protein of unknown function (DUF3556)
This family of transmembrane proteins is functionally uncharacterized. This protein is found in bacteria. Proteins in this family are typically between 576 to 592 amino acids in length.
Statistics
?
PSSM-Id: 403339
View PSSM: pfam12077
Aligned: 24 rows
Threshold Bit Score: 878.16
Threshold Setting Gi: 502892495
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_012393417           1 MGFFKPRFPDVDPDTFLRKPLMERGRILAQSWVEYGFPSPRMVHAIYILKLIfGYALGGVIVAT-LTSGLPAFWHVAAWW 79  Mycobac...
WP_014376042           1 MGFKTADMPPVDPAQFESMPFMERMRMLATHWCEYGFGGPKTNHMLYVYKLI-FYVVGGVAVVAlTTPGLGGIGDFGSWW 79  Blastoc...
WP_009154076           1 MGFKTPDMPPVDPAKFESMPVMERMRMLAVHWTEYGFGGPKQMHMLYLIKTV-LFVVGGWLVVGlTTPGL-SLTDLGAWW 78  Sacchar...
Q0SB21                 1 MGFKTGNFPEVDPATFLDLPFRDRLRAMSTHWVDYGFGTPKMVHTIYILKLLvLYLGVGLTLAT-FTSGLNVL-DVGAWW 78  Rhodoco...
goetting:GPOL_c24330   1 MGFTTPDFPPVEPETFLDRPFLDRLRVLGAHWAEYGFGTPKMVHTIYLIKVGvLYIVAGLCIAT-FSSGLNVV-DVGSWW 78  Gordoni...
WP_013127471           1 MGFLQPAFPPVDPDEFLARPIRERVTFATQHWVDNGFGSAWGIYLVYIAKLVvLFAFGGVLVAT-ATSGL-RFWEIGQWW 78  Tsukamu...
zhongguo:AS9A_4458     1 MGFTKPHVPPVVPEEFLKKPLMERMRILATDWVDYGFGAPKMVHTIYIFKIVvLYALGGVIFAT-TTSGLPAFWNVTEWW 79  Hoyosel...
WP_025346999           1 MGFTKPDLPAVDPDTFLQKPLMERMRVLGADWAENGFGSPKMVHCVYILKLVvLYAIGGITVAT-LTSGLPAFWHVAEWW 79  Nocardi...
Q741C9                 1 MGFMTPEFPDVDPQTWTGLPRSTRRQIMTRHWVEHGFGSPYAVYLFYVFKIA-GYIAGAAAVIS-LTPGLGGLGRIADWW 78  Mycobac...
WP_013829209           1 MGFIKPSVPDVDPEGWRSTGWAARIQICSRHWAEHGFGTPSGVYLIYLLKVV-AYAVGAAAVIA-LTPGLGGLSRIGDWW 78  Mycolic...
WP_012393417          80 NQPIVYQKVILWTVLLESIGVAGSWGPLAGKIKPMTGGIRFWARPGTIRLRPW-KWVPFTKGDRRTLLDVALYVALLVSV 158 Mycobac...
WP_014376042          80 GELIVYQKLIIWTVLFEITGWASSSGPLAFKFKPFIGGFLYWTRRNTLRLPPWpGKVPFTKGDHRTTFDVALYVTILATL 159 Blastoc...
WP_009154076          79 GELIVYQKLMVWTVLWEITGHAASWGPLAFKFGPMIGGWRYWARPGTLRLPPYpGKVPGTAGDRRSAFDVGLYLLIVANL 158 Sacchar...
Q0SB21                79 NEPIIYQKLILWTVLLEAVGLAGSWGPLAGHFKPMTGGILYWLRPGTIRLPPWpGKVPLTSGDTRTVGDVLIYAAVLVNI 158 Rhodoco...
goetting:GPOL_c24330  79 NELIVYQKVVLWTVLLETLGLGGSWGPLAGHFKPMTGGFLFWLRPETIRLPPWpGRVPFTRGDSRTVADVVVYAAILITI 158 Gordoni...
WP_013127471          79 NQPIVYQKLVLWTTLLEAIGIAGAWGPLTFKIKPMTGGIRFWARTGTIRLRPY-SWVPLTEGNRRTGVDVGLYLGLLTAL 157 Tsukamu...
zhongguo:AS9A_4458    80 NQPIVYQKLILWTVLLECLNVAGSWGPLAGKFKPMTGGWRFYAKRGTIRLRPW-KWVPLTSGDRRTSVDVGLYLALLASL 158 Hoyosel...
WP_025346999          80 NQPIVYQKAVVWTVLLEVVGLAGSWGPLAGKVKPMTGGILFWARPGTIRLRPW-KWVPGTAGDRRTWFDITLYLALLASL 158 Nocardi...
Q741C9                79 TQPIVYQKLVVFTLLFEILGLGCGSGPLTARFWPPFGGFLYWLRPNTIRLPPWpDKVPFTAGDSRTVVDVALYLVVLGSG 158 Mycobac...
WP_013829209          79 TQPIAYQKLVVFSLLFEILGLGCGSGPLTARFWPPIGGALYWLRPNTIRLPPWpGKVPFSSGDTRTVIDVALYAGVLASG 158 Mycolic...
WP_012393417         159 AVALFSPGVpsdsLSAALPGNTSGLVSPALLIAPMVLLVLVGLRDKTIFLGARGEQYLPAMFFFAVLg-FANfadMIIAL 237 Mycobac...
WP_014376042         160 VFLLVTPGF----ESSALPGSEAGLLPQWGLLTYVALIIVMGLRDRVVFLAARSEQYVAVLFFFGILsnHVD---MVLAA 232 Blastoc...
WP_009154076         159 LFLLLSPGV-----QNAAAYTDVGLLPGWALLSYVALLLIMGLRDRVVFLASRPEQYAVCLLAFGVLasHVD---MVLVA 230 Sacchar...
Q0SB21               159 VVALILPGVhtssIDAAITDN-SGLVRPAVLFPLIALLVLIGLRDKVIFIAARSEQYLPAIVFFGVLp-FVD---MIVAL 233 Rhodoco...
goetting:GPOL_c24330 159 VVALALPGVasssMNSVVAGD-HGVVNPVVLYPLIALFVVIGLRDKVIFIAARSEQYLPALVFFAFLp-YVD---MILAL 233 Gordoni...
WP_013127471         158 IVGIALPG-------GPVGDSPSALLPSWSMVAPIALLILIGLRDKTIFLGARGEQYLPAMIMFAVFp-LLSfatMIVGL 229 Tsukamu...
zhongguo:AS9A_4458   159 VVALAMPGVssesLSQALPNNTSGLVSPALVGLSVVLLIVLGLRDKVVFLAARGEQYLPAMIFFTALs-FTD---MIIAL 234 Hoyosel...
WP_025346999         159 VVALALPGVhsdsLAAVLPDNTSGLIAPAVVAAPIVLLILNGLRDKVIFLGARGEQYLPALIAFTVFp-FVN---MIIAL 234 Nocardi...
Q741C9               159 VAALLSPGR----GGPVTAAGDVGLIDPVLVVPAIVALALLGLRDKTIFLAARGEHYGLTLLVFFFG--FTD---QIAAF 229 Mycobac...
WP_013829209         159 IWVLLSPGR----GEP----GPVGLLDPMLVVPMIAALVLLGLRDKTIFLAARAEHYGLTLLVFFFP--YVD---QMAAF 225 Mycolic...
WP_012393417         238 KLLIVVVWVGAGASKFGKHFANVIPPMVSNSPAIAFR---WLKRAHYRNFPRDLRPSRLAEVMAHAaGTTVEILAPLTLL 314 Mycobac...
WP_014376042         233 KIAVVTIWMGAGISKFGHHFTNVVPPMMSNTPWLTSL---RFKRALYRDYPNDLRPSKLAWAFAHIgGTVVELVLPLVLL 309 Blastoc...
WP_009154076         231 KIAMVVIWLGAGVSKFGHHFSLVVQAMMSNTPWLRSK---RFKRSLYRNVPTDLRPSKMALGWAHLgGTVVELCLPLVLL 307 Sacchar...
Q0SB21               234 KLLIVSVWVGAGVSKLGHHFSMVVPPMLSNTPWMPFK---KIKRAHYRNFPEDLRPSIVAGGVAHVlGTVVEVVTPLVLL 310 Rhodoco...
goetting:GPOL_c24330 234 KLLIVTVWVGAGISKLGHHFSMVIPPMLSNTPWLPFR---SIKRAHYRDFPHDMRPSRLASGVGHVlGTIVEIVTPLVLL 310 Gordoni...
WP_013127471         230 KLLIVSIWVGAGLSKIGRHFIMVIPVMVSNSPCMPFT---GLRRAHYRNAPNDLLPSKLSRFMAEGlGTFVEIAAPLILL 306 Tsukamu...
zhongguo:AS9A_4458   235 KVLILVVWVGAGFSKFGKHFANVVPPMVSNSPSTPFK---SLKRAHYRNYPNDLRPSKLAHFMAHVnGTAVEIAAPLVLF 311 Hoyosel...
WP_025346999         235 KLLIVVVWVGAGFSKLGKHFSNVVPPMVSNSPSVPFK---SVKRAHYKDFPRDMRPSGVAHFMAHVnGTCVEMLVPLVLL 311 Nocardi...
Q741C9               230 KIIMLALWWGAATSKLNHHFPYVVAVMMSNSPLLRARafnWFKRRLYLDPVDDLRPSWIPKVMAHVgGTTAEFLVPLVLV 309 Mycobac...
WP_013829209         226 KLIILGLWWGAATSKLNHHFPYVVAVMTTNNALLRSKiftGVKHLMYRDHVNDLRPTRIPQLMAHVgGTTAEFVVPALLV 305 Mycolic...
WP_012393417         315 F-STNKWLTLAAAALMVSFHLFIISTFPLAVPLEWNVLFAYATIFLFLGFPawqGYGVTSMSSPWLLAAIVAALLFFPIL 393 Mycobac...
WP_014376042         310 F-STNSTITWLAIVGMVVFHIFITSTFPLAVPLEWNVFFMFAPVWLFAGFPaseGYGVGDISSPWLLAAILAVFVAFPIL 388 Blastoc...
WP_009154076         308 F-STNATITWLAIAGMVLFHLFIYSTFPLAVPLEWNVFFIFVVPFLFGGFFagnGYSVVDFSSAWILAAALILCLTGPIL 386 Sacchar...
Q0SB21               311 F-STNRTLTLLAVVLMVAFHLFILSTFPLAVPLEWNLLFAYASIFLFLGFPawdGYGVADMSSVWLTAVIVAALVFFPIL 389 Rhodoco...
goetting:GPOL_c24330 311 F-STNKWLTLAGVVLMVCFHLFIFSTFPLAVPLEWNILFAYASIFLFWGHPtwdGFALTDTTMPWVLALIAAALCFFPVL 389 Gordoni...
WP_013127471         307 F-STNRTLTVVCAVFMVCYHLFIISTFPLAVPLEWNLLFAYTAVFLFVGFPaqeGFSVLDMSPAWLALPTLAALAFFPVL 385 Tsukamu...
zhongguo:AS9A_4458   312 F-STNKWVSLAAALLMIAFHLFIISTFPLAVPLEWNVLFAYATAFLFLGFPnrdGYYITDMSSPWLLVLVVGGLLFFPVL 390 Hoyosel...
WP_025346999         312 F-STNKWLTLVAALIMVIFHLFIVSTFPLAVPLEWNVLFAYATVFLFLGFPawnGYAVWDMSPVWLVVPVAAALLFFPVL 390 Nocardi...
Q741C9               310 FvADGHRWAWFLIAFMVLFHLNIASTIPMGVPLEWNVFFIFSLFYLFGHYA---GVTATGLSSPLLLGILIAALAVVPIL 386 Mycobac...
WP_013829209         306 LvAGDHPWRWFLIAFMVVFHLNILSNLPMGVPLEWNVFVLFSLFFLFGQHP---EISVYDLRSPWLLAILLVGLVVIPVA 382 Mycolic...
WP_012393417         394 GNFRPDKVSFLPSMRQYAGNWASAVWAFA-PGTEHKLNK-VTRSSKNQLDQFIDFgYEPQWAEITMQHSI-AWRSMHSQG 470 Mycobac...
WP_014376042         389 GNLRPDLVSFLPSMRQYAGNWASAAWAFRgDEAEDKLNKhLVKYNPNQVDQLSGA-FGKEIAEIFMQKAV-AWRTMHSQG 466 Blastoc...
WP_009154076         387 GNLRPEWVSFLISMRQYAGNWASATMAFRmNDAEDKLDTgLVKSMKTQRQQLLSL-YGSDVAEIFLQKCV-AFRSMHSHG 464 Sacchar...
Q0SB21               390 GNLRPDLVSFLPSMRQYAGNWASATWAFA-PGAEEKLDEhIVRPSKNTRTQLLAT-YPPEVADVVMHQLL-GWRSMHSQG 466 Rhodoco...
goetting:GPOL_c24330 390 GNLRPDLVSFLPSMRQYAGNWASATWAFA-PGAEDKLDQcVVRSSKNTRTQLLAS-YPPEVADVVMHQMM-AWRSLHSQG 466 Gordoni...
WP_013127471         386 GNIRPDKVSFLPSLRQYAGNWATGMWAFA-PGAEEKLNR-VQRPVHNTVDQFVSFgIERKWAEVLLEKGL-GWRALHSNG 462 Tsukamu...
zhongguo:AS9A_4458   391 GNLRPDKVSFLPSMRQYAGNWATALWAFK-PGCEDKLNR-VTRSAGNQIDQLIETgTEREWAEVTMQKTI-AWRSLHSQA 467 Hoyosel...
WP_025346999         391 GNLRPDKVSFLPSMRQYAGNWASAVWTFA-PGTEEKLNR-VTRSAGNQIDQFIEFgYEPQWAEITLQKTI-AWRTLHSQG 467 Nocardi...
Q741C9               387 GNLFPQQISFLPAMRYYAGNWATSTWCFR-RGAEDKIEAnITKASALVPNQLARL-YDPQSAELMIDKLM-GWRSMHTHG 463 Mycobac...
WP_013829209         383 GNMFPQQISFLPAMRYYAGNWAASFWCFR-AGTEDTLETnIVKSSALVINQLAKF-YDQATADLVADKVPgAFRAMHLHG 460 Mycolic...
WP_012393417         471 RGLFSVLLKNLP---DIDTRTVREGEFICNSLIGFNFGDGHLHNEDLIAAMQTQAAFEPGELVVVWVESQAWGSKVQHYK 547 Mycobac...
WP_014376042         467 RGLMSLMMRHLD---RLENYRIREGEFVCTTLVGWQFGDAHLHNEQTITAVQQRCGFEPGECIVVWVESQPIHRPTQEYK 543 Blastoc...
WP_009154076         465 RMHLSLLQRHLD---KLENYRLREGEVVCTVLVGWQFGDGHLFDERTIAAVQQRCGFEPGEFVMAWTESQPIHKKTVRYM 541 Sacchar...
Q0SB21               467 RALFSLMMRHLGd--DIDTYSLREAEFSCNSLVAFNFGDGHLHNEFLIAALQRRCNFAPGEFVVAWIESQPIHKGTQQYK 544 Rhodoco...
goetting:GPOL_c24330 467 RALFSLMMRHLGd--DIDTYTLREAEFSCNSLVAFNFGDGHLHDEKMIAALQRRCDFAPGEFTIAWIESQPIHKGTQRYK 544 Gordoni...
WP_013127471         463 RGLFSMMLRHVP---DVEQRTLREGELVCNTLIGFNFGDGHLHDERLIAAVQEQVGFDPGELIVVWAESQPVTRMSQDFK 539 Tsukamu...
zhongguo:AS9A_4458   468 RGLFSLLLTRLP---DIETRTVREAEFLCNSVLGFNFGDGHMHDVDMIQAVQDEAQFEPGELIVVWVESEAFGSGVQHYK 544 Hoyosel...
WP_025346999         468 RGLFSLLIARLP---DIDSRTVREGEFLCNSIVGFNFGDGHFHGEEMIRAVQDEARFEPGECVVAWVESEAVGSGVQHYK 544 Nocardi...
Q741C9               464 RALGGLVPRALPggaDEADYLLRDGEIVAGPLIGWNFGEGHLHNEQLLAAVQRRCNFDEGEVRVIILEAQPIQRQTQAYR 543 Mycobac...
WP_013829209         461 RALNGLVYRAVE---NLADYSIRDGEIIAGPLIGWNFGEGHLHNEQLLAAVQRRCHFAEGDLRVIVLEGQPIHRQEQAYR 537 Mycolic...
WP_012393417         548 VIDAALGVLERGTWKVADAVAEQPWl-pNGPIPTQVT 583 Mycobacterium marinum
WP_014376042         544 VIDAALGVVERGYWNVAEAVAEQPWl-pNGPIPHTVT 579 Blastococcus saxobsidens
WP_009154076         542 VVDAALGVVERGYYDVRDAVAEQPWi-pNGPVPHQVT 577 Saccharomonospora marina
Q0SB21               545 VIDAALGVIERGTYKVSDAINEQPWl-pNGPIPFDVQ 580 Rhodococcus jostii RHA1
goetting:GPOL_c24330 545 VIDAALGVIETGTYRVADAVAEQPWl-pNGPIPVQVD 580 Gordonia polyisoprenivorans VH2
WP_013127471         540 IIDAALGVIARGRWNVTDCVTSQPWl-pDGPVPCEIT 575 Tsukamurella paurometabola
zhongguo:AS9A_4458   545 VIDAAIGVIEKGTWNVADAVVEQPWl-pNGPIPLNPT 580 Hoyosella subflava DQS3-9A1
WP_025346999         545 LIDAALGVIERGTWRVADAVAEQPWl-pHGPIPLRPT 580 Nocardia nova
Q741C9               544 IVDARTGLIEAGHVDVASMLSRQPWpepGDEYPVHVh 580 Mycobacterium avium subsp. paratuberculosis
WP_013829209         538 IVDAKSGLIEAGYVAVADMLSRQPWpepGDEFPVRIT 574 Mycolicibacter sinensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap