Conserved Protein Domain Family
DUF3544

?
pfam12064: DUF3544 
Domain of unknown function (DUF3544)
This presumed domain is functionally uncharacterized. This domain is found in eukaryotes. This domain is typically between 198 to 216 amino acids in length. This domain is found associated with pfam00628, pfam01753, pfam00439, pfam00855.
Statistics
?
PSSM-Id: 403328
View PSSM: pfam12064
Aligned: 11 rows
Threshold Bit Score: 260.599
Threshold Setting Gi: 528517309
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_022538483  469 GGSGRRISMTDIPRSPMSTNSSAHTGSDGEQEGGEKSQAKVP--LPHQTGGEESLESTaspaap----rpgpaGSAVDSP 542  Mexican tetra
XP_014324866  444 STTGQRHPLGDGQRSPMSTNSSAHGGSDGEQETADRTQTKSA--NSQSSAGEESTDCT---------------GNSLDSS 506  southern plat...
XP_692886     441 SGTGRRISMTDMPRSPMSTNSSAHTGSDGEQETAEKGHAKAA--LPHYSTGEESQDCTaspa-------ssraGSTLESP 511  zebrafish
XP_012827113  172 SSGGRRISLTDMPRSPMSTNSSVHTGSDVEQE-ADK---KVA--SSHFSASEESMDFTdkstaspkstkvghgGNIADSP 245  tropical claw...
XP_013130455  424 ssmnRRVSMTDMPRSPMSTNSSVHTGSDGEQD-VEKGN-RNP--ALHYSTGEESMDCTaspvsg----kmgpgGSVSGSP 495  Nile tilapia
XP_022533321  346 AGAGRRISMTDMPRSPMSTNSSVHTGSDLEQDASERGT-KLQ--SSHCSAGEDSMDCTaspa----------sqkTTGSP 412  Mexican tetra
XP_005162002  418 GGGGCRISVTDMPRSPMSTNSSVHTGSDLEQD--ERGA-KMS--SSHCSAGEDSMDCTaspa----------slkTSGSP 482  zebrafish
XP_028431898  419 STAGRRLPLNEMPRSPMSTNSSAHTGSDGEHDTADKSQTKAP--NSQYSTGEESMDCTgispaspahprpcpaGSSLDSP 496  yellow perch
AAG34905       42 GGTGRRISLSDMPRSPMSTNSSVHTGSDVEQD-AEK---KAT--SSHFSASEESMDFLdkstaspastktgqaGSLSGSP 115  human
CAF96847      281 TTAGRRLPLTDIPRSPTSTNSSAHTGSDGEQETADKSQTKVPvtNNQYSTGEESMDSTaspahp----rpgpaGSSLDSP 356  spotted green...
XP_011473674  418 NTAGRQPPVSDVPCSPVSTNSSAHTGSDGEQEAADKSQAKAT--AGQCSTEEESMDCTg---------------NSLDSP 480  Japanese medaka
XP_022538483  543 KPFHST--TPSTPiKQEKTPTTGSILNLNLDRSKAEMDLKELSETVqqqqqQQQQGPQASLTSPKRQIRSRFQLNLDKTI 620  Mexican tetra
XP_014324866  507 KPPHSQ--TPDTS-KQEKAPQTGSILNLNLDRSKAEMDLKELSETV-----QQKQGAAPALTSPKRQIKSRFQLNLDKTI 578  southern plat...
XP_692886     512 KPFHSP--APNTPvKQEKTPTTGSILNLNLDRSKAEMDLKELSESV-----QQQQGAQPSLTSPKRQIRSRFQLNLDKTI 584  zebrafish
XP_012827113  246 KPFSPQssTPVSS-KQERSATTGSILNLNLDRSKAEMDLQELSESV-------LQSTPTPLISPKRQIRSRFQLNLDKTI 317  tropical claw...
XP_013130455  496 KPF-----NPGLVpKQERTAGTGGILNLNLDRVKAEMDLKELSETVqq--qQQQQGVPAPPSTPKRPIRS-----LDKTI 563  Nile tilapia
XP_022533321  413 KPV-----LPAPL-KQERTQTTGSILNLNLDRIKAEMDLKELSESVqq--qQQQQGASVVLTSPKKPTRS-----LDKTI 479  Mexican tetra
XP_005162002  483 KPL-----LTTPV-KQERSSGTGGILNLNLDRVKAEMDLKELSEAVqqqqqQQQQGASVLLTSPKKPTRS-----LDKTI 551  zebrafish
XP_028431898  497 KPFHSQ--APGVP-KQEKTPPTGSILNLNLDRSKAEMDLKELSETV-----QQKQGATPVLTSPKRQIKSRFQLNLDKTI 568  yellow perch
AAG34905      116 KPFSPQlsAPITT-KTDKTSTTGSILNLNLDRSKAEMDLKELSESV------QQQSTPVPLISPKRQIRSRFQLNLDKTI 188  human
CAF96847      357 KAFHGR--PAGMS-KQEKAPPTGSILNLNLDRSKAEMDLKELSETV-----QQKQGATPVLTSPKRQIKSRFQLNLDKTI 428  spotted green...
XP_011473674  481 KTMNSQ--APGIT-KQERPPQTGSILNLNLDRSKAEMDLKELSETV-----QQKQGATVALTSPKRQIKSRFQLNLDKTI 552  Japanese medaka
XP_022538483  621 ESCKAQLGIDEISEDVYKGVEHSDSEDSDKSDSSDSEYASDDEQKPKSSQESSADD 676  Mexican tetra
XP_014324866  579 ESCKAQLGIDEISVDVYKGVEHSDSEDSDKSDSSESEYATDEESKSKPGQDSAAKR 634  southern platyfish
XP_692886     585 ESCKAQLGIDEISEDVYKGVEHSDSEESDKSDSSDSEYGSEDEQKSKNGQNNKTTA 640  zebrafish
XP_012827113  318 ESCKAQLGINEIPEDAYTAVEHSDSEESEKTDSSDSEYVSDEEHKTKNEQEDVEDK 373  tropical clawed frog
XP_013130455  564 ESCKAQLGIDEISEDAYKDVDHSDSEDSEKSDSSDSEYLSDEEHKPKSSAQEDKDK 619  Nile tilapia
XP_022533321  480 ESCKAQLGIQEISDDVYRGVDHSDSDDSDKSDSSDSEYASEEEHGPKESNQDNGAH 535  Mexican tetra
XP_005162002  552 ESCKAQLGINEISDDMCGGVEHSDSEDSDKCDSSDSEEMSDDEQKPKNTNHNNSVH 607  zebrafish
XP_028431898  569 ESCKAQLGIDEISVDVYKGVEHSDSEDSDKSDSSDSEYASDEEQKTKDGRDAAPND 624  yellow perch
AAG34905      189 ESCKAQLGINEISEDVYTAVEHSDSEDSEKSDSSDSEYISDDEQKSKNEPEDTEDK 244  human
CAF96847      429 ESCKAQLGIDEISVDAYKGVEHSDSEDSEKSDSSDSEDSSDVEQKAKNNQDAASAS 484  spotted green pufferfish
XP_011473674  553 ESCKAQLGIDEISVDAYKGVEHSDSEDTDKSDSSESDSASDEEQNTKGDQDTANDK 608  Japanese medaka
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap