Conserved Protein Domain Family
DUF3538

?
pfam12057: DUF3538 
Domain of unknown function (DUF3538)
This presumed domain is functionally uncharacterized. This domain is found in eukaryotes. This domain is about 120 amino acids in length. This domain is found associated with pfam00240. This domain has a conserved SDL sequence motif.
Statistics
?
PSSM-Id: 403321
View PSSM: pfam12057
Aligned: 20 rows
Threshold Bit Score: 107.467
Threshold Setting Gi: 156222527
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_011603423  275 LAEMLSELQRMEERLQPFIQRAHAILETATNAEYNNhTE-REEDQRILVLTFEALRLLGNAIVALSDLRLNLLGPAPRHL 353  torafugu
Q9VS83        350 LAQVIQHYRGVQARLAPFVDRYYEILQNDPTFEESD-TDgRENAQRIFDRVSEAFHYLSHAQHAISDLMLDLSQPGPRVL 428  fruit fly
Q0IF29        296 LAEVVQQMRGVQRRMEPFLQQYFDILQNDPTFEESD-TAgRESAQRIFDRISEALHYMSHAQHAISDLMLDLQTATPRHL 374  yellow fever ...
Q16EV9        299 LAEVVQQMRGVQRRMEPFLQQYFDILQNDPTFEESD-TAgRESAQRIFDRISEALHYMSHAQHAISDLMLDLQTATPRHL 377  yellow fever ...
XP_001948996  355 lRELIEELNKLNERLRPFYAMYCQFIGDDPQFDTIEgEHgSLRAQTVFNGVSEVMHFISHVYHAISDLRVALNRPPPRSF 434  pea aphid
EFA01091      283 MAELLTTLNQLQTRFAPFLERYRHFMVEDPIIPQEN----VRQTQAMLTRVSEVLHFLGHAYHSLSDIIIRVRTPPPRPL 358  red flour beetle
XP_011262107  305 MAELLQRLINTQDRLRPYFERYCMLTRLDPLLPPGPgPNtVEESQRIVDGVSEILHFMSHACHALSDIIIDMSQPPRRNL 384  Florida carpe...
EGI63063      331 I--LLQRLCNTQERLRPYLERYCMLTLLDPSLPPGPgSQnVEENQRIVDGVSEILHFMSHCCHALSDIIIDMSQSPPRNL 408  Panamanian le...
OWR44770      234 fGQLVAELHELHNEFTPFREAYIMTLNEASDSNVQLtEDvLQRRQRTADLAAELYHSFSHAYHVVSDIGLMLAHRNSRLM 313  Danaus plexip...
EDO43370      222 LADVLGELQEFSSQLQPSLNRYTSLLNSPAT------ENlLPSDDSLPDRIAETLHNLSHAYHALSDLSINIRAPEPRRL 295  starlet sea a...
XP_011603423  354 HVl---RPFSHYAPSVALPGAvhhh-----ipvqMNL-GATMT--SNME 391  torafugu
Q9VS83        429 TC----RPILVEQSGYIRSNNift-------pnfLAPpSGIINepFRNr 466  fruit fly
Q0IF29        375 CC----RPMLVEQSAFVSSGIaavpvttpngpmnIPL-LDLVGqqNRPT 418  yellow fever mosquito
Q16EV9        378 CC----RPMLVEQSAFVSSGIaav-------pnnINL-ANLLRatNNNN 414  yellow fever mosquito
XP_001948996  435 QS----RPCLLQ-GTILHAah------------sVTT-TSTAAppSTQQ 465  pea aphid
EFA01091      359 LC----RPILIQHSAVVQAGIpi----------qVEV-AQFNLseRPNN 392  red flour beetle
XP_011262107  385 RC----RPIIVQHSAILQPSIpi----------qVEA-HISLNgrSANN 418  Florida carpenter ant
EGI63063      409 RC----RPIIVQHSAILQPGIpi----------qVEA-HISLNgrsann 442  Panamanian leafcutter ant
OWR44770      314 SEalmrHPLpl----------------------qAHI-NVVQTpaNRRQ 339  Danaus plexippus plexippus
EDO43370      296 SVl---TPLsp----------------------hVGA-PNLLSsiFGGR 318  starlet sea anemone
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap