Conserved Protein Domain Family
DUF3537

?
pfam12056: DUF3537 
Protein of unknown function (DUF3537)
This family of transmembrane proteins are functionally uncharacterized. This protein is found in eukaryotes. Proteins in this family are typically between 427 to 453 amino acids in length.
Statistics
?
PSSM-Id: 403320
View PSSM: pfam12056
Aligned: 43 rows
Threshold Bit Score: 409.679
Threshold Setting Gi: 1002291759
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_002894263  34 DELHSFRKYLRWMCVDHSSPWTAILSWTMFVVFTLVVPAISHFLLACadcdsYH--SR-PYDSVVQLSLSSVATVSFLCL 110 Arabidopsis lyr...
ERN12560      85 DELYNFRMSLRWWALDQSSKPTKLISWLTFCVFTLVVPITSLVLVRAp-------sRAiAIEKWVQLPESGLAAIAFFSL 157 Amborella trich...
EEF34410      45 DELRHFRICLKWCALDHSSCLGKFISYSTFIFFAIILPILSSLSVKLppsaaLR--DPiSFNTLVQLPESGLALIAFFTL 122 castor bean
XP_006382205  55 DELRNFRISLKWCALDHSTCIGKFVSCFIFVFLAIILPIVSSLSIRVpssapAN--DPiSYNKLVQLPESVLALISFFSL 132 black cottonwood
XP_003527815  49 HELRNLRRSLQWCALDHSSLVGQLISYVVFIFLTIAVPLFTSLFVHVpssssQL--DPfNFNKLLQLPQSALAVIAFFTL 126 soybean
XP_003545561  60 DELRNFRISLKWCALDHSSFIGRLISYVTFIFFTIVVPLFTSIFVEVpasapED--DPiSFNKLVQLPESGLAIVAFFTL 137 soybean
XP_009420001  56 DELRNFRVCLKWCALDHSTAAGRAVSYAAFVALALLVPAATSLSVRAppaasSSa-SSvSFHKLVQVPASSLAAISFLTL 134 wild Malaysian ...
XP_004973917  54 DELRSFRVFLQWCALDHSTRAGRAASYAAFLVLALLVPASISLSLRAdaslsPVsaSAiTFNRVSQVPATGLAVISFVTL 133 foxtail millet
EFJ27549       8 DELQRFRLSLLWIGLDQSTPVRIAFSWIIFLLFAIVLPVINSVATSCsr--cYH--RQlPFERLVYVSESALAIVSFACL 83  Selaginella moe...
XP_015650223  45 DELRSFRVFLQWCALDHSSRAARAASYAAFLALALAVPAAVSLSLRAdagasPVsaSAiTFNRVAQAPATGLAAISFAAL 124 Japanese rice
XP_002894263 111 TRFVSKy-GLRRFLFFD-KLWDESETVRRNYTNQLNTSLHIVSYFVIPCFSAMSAYK-IWWYASGGsqiPFLg------- 180 Arabidopsis lyr...
ERN12560     158 SRSVRKh-GLRKILFLD-QLAEDTHEIRRNYSSELERAFKGLAFMLLPSFSVELAHK-VVFFSCTDvgiLKG-------- 226 Amborella trich...
EEF34410     123 SRFFSTy-GLRQLLFLD-GLQDDSLFVRRGYSRELDKAFRYLACILLPSFFVELAHK-IIFFSTVEitlPYIs------- 192 castor bean
XP_006382205 133 FRFFKRy-GLRQLLFLD-DLQEDSLFIRRGYSRELDKAFRYLACILLPSFFVEVAHK-IIFFSTVKiwlPCNvf------ 203 black cottonwood
XP_003527815 127 SRFFPRh-GLRQLLFLD-VLQDDSTYVRRGYTRELQKAFRYLACMILPSFFVELVHK-IIFFSSVEisiPC--------- 194 soybean
XP_003545561 138 SSFFKRy-GLRQLLFLD-ALQEDTTYVRRGYTRELEKAFRYLTYIILPSFFMELAHK-IIFFSAVKisaPHIs------- 207 soybean
XP_009420001 135 AAFFRRy-GLRQLLFLDgALRDDTTFVRHCYARELDRSFRHLVYILLPSFSVELAHK-ILFFSTVSvavPLSta------ 206 wild Malaysian ...
XP_004973917 134 AAFFRRlgGLRQLLFLDgALRDDSPYVRRGYARELDRAFRLLAALLLPSLCVEAAHKaVFYFCTVRvdpPAAlgavlppl 213 foxtail millet
EFJ27549      84 SFLLRRh-GLRKVLMLE-KLDRESQEVQQNYRAKVNFAFRLLAMIILPSMVVKLVRE-IWWFSRATvalPGIp------- 153 Selaginella moe...
XP_015650223 125 ASFFRRggGLRQLLFLDgGLRDDTAFVRRGYARELDRAFRLLAALLLPSLCVEAAHKaVFFFATVRvepPLPlp------ 198 Japanese rice
XP_002894263 181 --nVVLSDTVACIMELCSWLYRTTVIFLVCVLFRLICHLQILRLQDFA-KLFQ-ID-SDVGSILSEHLRIRRHLRIISHR 255 Arabidopsis lyr...
ERN12560     227 ---GFAAKWVVFGFVLASWIYRTGVYLLVCVLFSLTCELQILRLQGLRkKLEDgGSeSEVGVIFREHVRIRRQLSVMSHR 303 Amborella trich...
EEF34410     193 --lGVPLNSVMFLLVLASWVYRTGVFLLVCVLFRLTCELQILRFEGLH-KLFE-GCeSDAGAIFKEHFRIKKQLSGTSHR 268 castor bean
XP_006382205 204 -pgNIPLNSIMFVLVLASWVYRTGVFLLVCVLFRLTCELQILRFDGLH-KLFD-GCeSDAGVIFREHVRIKKQLSFTSHR 280 black cottonwood
XP_003527815 195 ---GTSLNWVVFVLVLVSWVYRTGLFLLACVLFRLTCELQILRFEGLR-KLFE-GCgSDANMIFREHVRIRRQLWITSHR 269 soybean
XP_003545561 208 --pGFPLNSIVFVLVLVSWVYRTGVFLLVCVLFRLTCELQKLRFEGVH-KLFE-GCgSEAGVIFKEHVRIRRQLWVTSHR 283 soybean
XP_009420001 207 -psGVPWNSIAFIATLASWVYRTGVFLLVCVLFRLTCELQILRFEGFY-KMFDeGDgSHCQAIFREHMRIKRQLLVTSHR 284 wild Malaysian ...
XP_004973917 214 llpRVPWRAVALVATVASWVYRTGVFLLVCVLFRLTCELQILRFEGIH-HMFDvEArAAAAEIFAEHRRIRTQLLATSHR 292 foxtail millet
EFJ27549     154 --hGPALRSVMCTLVMLSWLYKAGVFLLMCVLFRLMCSLQILRLQGYS-TLLA-KS-LDVPELLLEHVRIRKQLFKISHR 228 Selaginella moe...
XP_015650223 199 -gvGVPWRAVALVATVASWVYRTGVFLLVCVLFRLTCELQILRFEGIY-HMFDvEArAAAAEIFAEHRRIRTQLLATSHR 276 Japanese rice
XP_002894263 256 YRSFILCLLILVTGSQFSSLLITTKAYTEVNMYRAGELALCSMTLVTALLILLRSASKITHKAQAVTCLAAKWHVCATLE 335 Arabidopsis lyr...
ERN12560     304 CRGFILGSLGTITVSQLGALIMVFSSKFQKDFFNSGDLLVCSAVQLCGVFLCLLGAAKITHRAQGIVSIATRWHASMTLE 383 Amborella trich...
EEF34410     269 YRFFIIACSVTITITQLGALLLVLAFKSEKNFFNSGDIVICSVVQLSGFFLCLLGAARITHRAQGIVSIATRWHMMVTSA 348 castor bean
XP_006382205 281 YRFFIISCLVTITVSQFGSLLLVLGFNNEKNFFNSGDLVICSAVQLCGFFLCLLGAARITHRAQGIVSMATRWHMIVASA 360 black cottonwood
XP_003527815 270 YRFFIITCLVTITISQLGSLLLVLESKSATTFFNSGDLVICSAVQLCGFFLCLMGAARITHRAQGIVSIATKWHMVVTNA 349 soybean
XP_003545561 284 YRFFIIGCVVTITVSQLGALLLVLASKSDKTFFNSGDLVICSAVQLSGFFLCILGAARITHRAQGIVAIATRWHMLVTTA 363 soybean
XP_009420001 285 YRIFILGCLVTISASQLGALMIVLASKSKKTFCNSGDVVVCSAVQLSGFFMCLLGAARITHRAQRVVSIASRWHMILSSA 364 wild Malaysian ...
XP_004973917 293 YRVFIICCLVTITVSQLGALLVALSSRDEKSFSNTGDLLVGSAVQLSGFFMCLFGAARITHRAQRIVSIASQWHVSLVAM 372 foxtail millet
EFJ27549     229 CRIFILASMFIITSSQFISLFFILSYKESVHFFIAGSLAVSSAVQLSGILTCMNGASKITHRAQKLISLVSEWHAVWTCS 308 Selaginella moe...
XP_015650223 277 YRAFILSCLVTITVSQLGALVVALSSKDGKSFANSGDLLVGSSVQLSGFFMCLFGAARITHRAQRIVSIASQWHMSMEAV 356 Japanese rice
XP_002894263 336 SFDQtvDGETPTlvarnnnndnnngH----DvitltESDSDEYGDEEDDLDN----NN-IIPAYAfS-----------TM 395 Arabidopsis lyr...
ERN12560     384 P-----KTKRSYsnsgeps-------------appingENFLATNNSSDPES----PDaLFISPSl------------HS 429 Amborella trich...
EEF34410     349 SSRS----EQGKclvr-----------------------etdDSIQTDDADP----PDiFITQD--------------AS 383 castor bean
XP_006382205 361 SASA--RIDQGKshvp-------------------eadGTLASNTEDSESDS----SDnFIAISSqD-----------PC 404 black cottonwood
XP_003527815 350 SAES----EHWKtqm-----------------------pegLPSPTASDSDS----SDiYISVTTq------------GP 386 soybean
XP_003545561 364 SAES----EHCEaqv-----------------------segLASDDDSDSDDs---SNiHVSVIPpQ-----------LS 402 soybean
XP_009420001 365 ADR---KADPPTpava-------------------esdDISDSGSPEGSVGGavphAQ--------------------AS 402 wild Malaysian ...
XP_004973917 373 HHGS--KSSP--------------------------------ASTSASDVDA----SRvSGSSAAvSsqae----pgaAC 410 foxtail millet
EFJ27549     309 AMTS--DFNKPAfktatppcypllrQqsdiK-----ACDLFSAKSQDSHYDN--------------------------EC 355 Selaginella moe...
XP_015650223 357 AHHA--KSAP----------------------------LPAAPSSSASDVDA--------------PhqpelgttttaAC 392 Japanese rice
XP_002894263 396 SFQKRQALVSYFENNRAGITVYGFTLDRGTLHTIFGL 432 Arabidopsis lyrata subsp. lyrata
ERN12560     430 SFEVRQAFVSYLQHNSGGITLFGFTLDRGLLHTIFAF 466 Amborella trichopoda
EEF34410     384 SFQTRQAFIAYLQHNHGGITLFGFALDRGLLHTLFAF 420 castor bean
XP_006382205 405 SFQTRQALVAYLQHNNGGITLFGFALDRGLLHTLFAF 441 black cottonwood
XP_003527815 387 SFQTRQALVTYLQHNYGGITLFGFVVDRGLLHTLFAF 423 soybean
XP_003545561 403 SFQTRQTLVTYLQHNHGGITVYGYSLDRGLLHTLFAF 439 soybean
XP_009420001 403 TFEGRHALVLYLQHNGGGITLFGFALDRGLLHTLFVf 439 wild Malaysian banana
XP_004973917 411 SYKSRQALVTYLRHNGGGITLFGFTLDRGLLHTIFVF 447 foxtail millet
EFJ27549     356 YFRQQQSFLRYLQHNSPGISVYGFVLDRGSLYTLFAL 392 Selaginella moellendorffii
XP_015650223 393 AYRSRHALVTYLCHNSGGITLFGFTLDRGLLHTIFAF 429 Japanese rice
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap