Conserved Protein Domain Family
DUF3525

?
pfam12039: DUF3525 
Protein of unknown function (DUF3525)
This family of proteins is functionally uncharacterized. This protein is found in viruses. Proteins in this family are about 360 amino acids in length.
Statistics
?
PSSM-Id: 152474
View PSSM: pfam12039
Aligned: 2 rows
Threshold Bit Score: 776.184
Threshold Setting Gi: 75565249
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q66225 1294 LVFEPVTRGKFTFIYPFGHWCLRDTNSMIVYEGRFVNQDATSVGDLFKLTKSRRPLKAGHTVHLVPFHVQKLLDSMDDKA 1373 Cryphonectria hypov...
Q80L37    1 LIFEPVTRGKYTFSYPFGHWCLRDTNSMIIYEGKFVDPRETSIGSPFKLSKSVRPVRPGAVFHLVPFHIQKLLDSMDEEP 80   Cryphonectria hypov...
Q66225 1374 QPYSASHNCTTVILESIMYRSVIGFLFAYGISWAVYMVLRPPQFAATCYQWAFPERTWDKSKMYQALGFAAGGTIPMEHV 1453 Cryphonectria hypov...
Q80L37   81 LPYSANHNCTTVILKGIMYRSALGFVFAYAVSWAVYLVLRPPQAAATVYHWMYPERSWDTSRLYHLLGFAAGGTVPMEVI 160  Cryphonectria hypov...
Q66225 1454 DNElevltvspPPEDEISrqpkvnippppndeevammtplpaetmekvfhDASRTPLPGENDdemlmrassihlpkqtee 1533 Cryphonectria hypov...
Q80L37  161 DEE--------PIEEKPS--------------------------------DVGRSEPIPDND------------------ 182  Cryphonectria hypov...
Q66225 1534 evadllepeqlatvwrpepvevcpeqvglapEQRKDEAISEWWMSDDSVKCVENDVLYMLSFLHGTNIPEDIRLELVELV 1613 Cryphonectria hypov...
Q80L37  183 -------------------------------KQKESDYDQEWWGSQDSIDTVSNDLCYLLSFLKDTAIPEEVKLDVVELA 231  Cryphonectria hypov...
Q66225 1614 YAQITEDEEHRIPEPPGTKILDMPDWRPGNWAKLIDETHRVLSQFSNYAPRILNEMTTWLRGLANNLYRVCEPILELLLR 1693 Cryphonectria hypov...
Q80L37  232 YTQFVRDEKERIPEPKGTRILVMPNWKPDNWARLIDETHRVLSQFTHYTPRVLNELVVWLKGLGENLYRVAEPILMLLVR 311  Cryphonectria hypov...
Q66225 1694 AMRAAITVSQRAARSVYQCMCHWLDVMYGGSAPKRIKTVWGLTGMIASGMTSQ 1746 Cryphonectria hypovirus 2-NB58
Q80L37  312 AMRAAKSVSDRATRSIYHCLCHWLDVMYGGSAPTRVKTVWGLTGLITSGMTSQ 364  Cryphonectria hypovirus 1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap