Conserved Protein Domain Family
DUF3523

?
pfam12037: DUF3523 
Domain of unknown function (DUF3523)
This presumed domain is functionally uncharacterized. This domain is found in eukaryotes. This domain is typically between 257 to 277 amino acids in length. This domain is found associated with pfam00004. This domain has a conserved LER sequence motif.
Statistics
?
PSSM-Id: 403305
View PSSM: pfam12037
Aligned: 29 rows
Threshold Bit Score: 261.455
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_001419248  17 SDQKFESEIKASRSNKSGANAaFDPEALERGAKALREINQSPYATKVLELSRTQEQTKQSELRAREAEAAAAAAAHATER 96  Ostreococcus lu...
XP_002266534  46 QSSVEKSEDKSEADEPRVSSSgFDPESLERGAKALREINSSPNAKQVFEIMRKQEQTRLAELAAEKAHQEAIQAQADIDK 125 wine grape
XP_002884128  49 DQKSSSNETKPDSDEPK--GSgFDPESLERGAKALREINSSPHSKQVFDLMRKQEKTRLAELAAEKEHNEAIQAHKDIER 126 Arabidopsis lyr...
KRH28685      50 NQTSDSKSEPPPPDEPN-KSGgFDPESLERGAKALREINSSPYSKQLFDLMRKQEETRLAELDAEKVHYELIQSQGDIER 128 soybean
XP_003540124  38 EVQPSPAPPKVRNDHPRTTSAgFDPEALERGVKALREISKSPHGKKVFEVIKKQEETKQTELAAKVAEFRQMKAQHETER 117 soybean
EFH48003      64 AGEESDAPPRIRNNNPRTTSAgFDPEALERGAKALKGINNSAHAKKVFESIKTQEETRQAEFTAKAQEFKAMQSQAEAER 143 Arabidopsis lyr...
Q6Z8F7        60 PAPAAEEKRKVRNDHPRTSAAgFDPEALERGAAMLKQIENSPHGKKVFEILKQQEDVRRAENLTKKVEFQKELAAIELEK 139 Japanese rice
EES07415      68 REDAPEEPPKVSTQHPRTSAAgFDPAPLERGVEALNQINKSPDPKKLFELMKKREETHQQEIAAKKLEFQKSLAEIELEQ 147 sorghum
XP_002982368  10 VVQQREEYSKPRNDNPRTTAAgFDPEALERGAKALREINSSPHSKKVFELMRKQEDSRQAEEATRRAEFQAVQAQHETDR 89  Selaginella moe...
EDQ65563      51 ATPTPVKEEKPRNDAPRTSAAgFDPEALERGAKALREINASNHAKKVFELMKKQEETRQIEENARRAEYQAMQAQHETER 130 Physcomitrella ...
XP_001419248  97 EKVMWSEQSRVEKERSQQQAQLKQYDDELARKRMATEHEQRRQRNAEMVKLQEEGVERQEAIKrateekiqrerRETERY 176 Ostreococcus lu...
XP_002266534 126 QRKMAEEQMNLVQQQAQAKAQMLRYEDELARKRMQTDHEAQRRHNVELVKMQEESSIRKEQARrateeqiqaqqRQTEKE 205 wine grape
XP_002884128 127 QRKLAEDQRNLVQQQAQAKAQMLRYEDELARKRMQTDNEAQRRHNAELVSMQEESSIRKEKARiateqqiqaqqRQTEKE 206 Arabidopsis lyr...
KRH28685     129 QRKMAEEQRNLIQDQAQRQAQVLRYEDELARKRMQTDHEAQRQHNVELVKMQEQSSFRKEQARqateeqiqsqqRQTERE 208 soybean
XP_003540124 118 QRIIYDEQKKLAQHQAQTKSQMAKYEDELARKRMQAENEYHRARNQELVKLQEESSIRQEQARrateeqiqaqrRQTERE 197 soybean
EFH48003     144 QRVIYEEQKKLAQHQAQTKSQMARYEDELARKRMQAENEAQRTRNQELVKMQEESAIRREVARrateeeiqaqrRQTERE 223 Arabidopsis lyr...
Q6Z8F7       140 TRVDYDERKKLEQQRAQVKSQMSRYEDELARKRMQADHEAQRVRNQELVKMQEESAIRQEQMRraieeqiqeerRKTDRA 219 Japanese rice
EES07415     148 KRVDFEERKKLDQQRAKFKSQTAQYEDELKRKRLQAEHEAQRIRNQELVKMQEESGIRLEQIRrateeqiqeqrRQTERH 227 sorghum
XP_002982368  90 QRVMYEEQKKLVQQQAQTKAQISRYEDELARKRMQAEHEAQRARNSEMVKMQEESAVRQEQARrlteehiqaqrRQTEKE 169 Selaginella moe...
EDQ65563     131 QRVIYEEQKKLLQQTAQNKAQLARYEDELTRKRMQSEHEANRQRNQELVRMQEEAALRQEQIRrnteeqiqaqrRQTEKE 210 Physcomitrella ...
XP_001419248 177 RAELERENLRAKAIAEAEGRIAENRKNEDVIRRQMIAKVTAETDKAVKLVNETLGLIGGGFNSILGDRDRMMMFVGSATA 256 Ostreococcus lu...
XP_002266534 206 RAEIERETIRVKAMAEAEGRAHEAKLTEDHNRRMLIERMNGEREKWLAAINTMFSHIEGGFRVLLTDRNKLLMAIGGATA 285 wine grape
XP_002884128 207 RAELERETIRVKAMAEAEGRAHEAKLTEEQNRRMLVDKINGEREKWLAAINTTFSHIEGGVRTLLTDRSKLIMTVGGITA 286 Arabidopsis lyr...
KRH28685     209 RAEIERETIRVKAMAEAEGRAHEAKLTEDHNRRMLIERMQGERDKWLAAINTTFSHIEGGLRALLTDRDKLLMTVGGATA 288 soybean
XP_003540124 198 KAEIERETIRVRAMAEAEGRAHEAKLAEDVNRRMLVDRANAEREKWVAAINTTFEHIGGGLRAILTDQNKLVVAVGGVTA 277 soybean
EFH48003     224 KAEIERETIRVKAMAEAEGRARESKLSEDVNRRILVDRANAEREKWVSAINTTFDHIGGGLRTILTDQNKLIVAVGGLTA 303 Arabidopsis lyr...
Q6Z8F7       220 KAIVEKEIEQEKILAEANARIKLKKQTEDVERRLLIEGAKAEKEKWVQLINTTFEHIGGGLQTILTDQNKLVVAVGGVTA 299 Japanese rice
EES07415     228 KADLEQKTISKKAMAEAEGRILVTKQTEDVKRRLLLEEINADREKWIQVINTTFEHIGGGLRTILTDQNKLVVAVGGITA 307 sorghum
XP_002982368 170 KAEIERETIRVRALAEAEGRAHEARLAEDVNKRLLVERANSEKEKWLASINTVFTHIGGGIKTLLTDQDKLVVAVGGVVA 249 Selaginella moe...
EDQ65563     211 MAEIERETIRVKAMAEAEGRAHEAKMAEDVNRRLLVERANMEKDKWLAAINTTFSHIGGGIYAILTDQNKLVVAVGGATA 290 Physcomitrella ...
XP_001419248 257 LAAGVYASREGARFGFRQLEKYIGQPSLIR 286 Ostreococcus lucimarinus CCE9901
XP_002266534 286 VAAGVYTTREGARVTWGYINRILGQPSLIR 315 wine grape
XP_002884128 287 LAAGVYTTREGARVTWGYINRILGQPSLIR 316 Arabidopsis lyrata subsp. lyrata
KRH28685     289 LAAGIYTTREGSKVTWGYINRILGQPSLIR 318 soybean
XP_003540124 278 LAAGVYTTREGARVIWGYIDRILGQPSLIR 307 soybean
EFH48003     304 LAAGIYTTREGAKVIWSYVDRILGQPSLIR 333 Arabidopsis lyrata subsp. lyrata
Q6Z8F7       300 LAAGIYTTREGARVVWGYVDRILGQPSLIR 329 Japanese rice
EES07415     308 LAAGIYTTREGARVVWGYVDRILGQPSLIR 337 sorghum
XP_002982368 250 VAGGVYTTREGARVLWGYVDRILGQPSLVR 279 Selaginella moellendorffii
EDQ65563     291 LAAGVYTTREGARVLWSHIDRILGQPSLVR 320 Physcomitrella patens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap