Conserved Protein Domain Family
DUF3517

?
pfam12030: DUF3517 
Domain of unknown function (DUF3517)
This presumed domain is functionally uncharacterized. This domain is found in eukaryotes. This domain is about 340 amino acids in length. This domain is found associated with pfam00443.
Statistics
?
PSSM-Id: 403300
View PSSM: pfam12030
Aligned: 62 rows
Threshold Bit Score: 250.296
Threshold Setting Gi: 242005600
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ERT01506           2169 PEILKQMVQRSLDPEVRLEMGRLIIGSLKSIKSAfpisYTSFEDEPemdtdddeqsgvgvlgkrTELHRSSSIIHSAAYM 2248 Sporoth...
EMR70596            294 PFVHKILSHKNPEPTIRQETAYMLIAAISNIKVNfpdeYGIPDGQGdd--------------diRLLGQEDTIIMQTVDM 359  Eutypa ...
EJP68825           1796 PAVLRSLLLRNPERNVRSAIGHLFVVCMEKLSKScpdsYYTRTSAVwlgsgd------ededmdGDDAENEGMLSRAVKL 1869 Beauver...
XP_013943732       2067 HEAFRMLAQRHPDAAVRNFSCKMLIIAMEKIATEmpnvYDPLSANIviqddrsdi-avdspasrSPSSPRPSVLDEAMFL 2145 Trichod...
XP_006968076       2071 HEAFRGLVQRNPEAKIRAFAGATTAIVLGKIAAEtpqlYDGPRSSDdatpddgeggstsnslghDELSPKAYVLTGVMCS 2150 Trichod...
EHK18749           2084 PEAFRALVQRNPDADVRAFTGTTMVTVLRKIATEmpqiYDRLSRIDdenela------snssghEESLLKPYVLEEVMVS 2157 Trichod...
XP_003048790       2106 HDALRALLQRNPEMAVRNFMSKMFTVAIHKIAKGlphvYDPPVPNSpisdpd------gdenitEGAVAHRSVIDGVMLL 2179 [Nectri...
CCT71346           1952 PSALRMLLQRNPDQLVRSKIKNLFKVAVTKISTAlpnvYDPEIRYKlvhdad------gdetlsEPDASHRSVIDGVMMI 2025 Fusariu...
WGS:ADNJ:MAA_03552 2152 HGAFRSLVQRNPDPDIRSFTGKTLVLAASKIRSGlprlYHCPVPTRtdsspas----mdseddwDDSEPPPSVLQGIMSI 2227 Metarhi...
XP_009657155       1995 PEAFRQLVQRNPEPSYRLATGDMLIIALEEIREHdpayYGPEAPPAd-----------------DEILVPNSAIDGALIL 2057 Vertici...
ERT01506           2249 MQILWETFHLVSRSWNEVFGFMLAFASMGREEVGIFLDLEGFRRTILTISADTAFP-LDQQFSRMVIMLQRRn---RPPS 2324 Sporoth...
EMR70596            360 FTKLWDTFHNTLRSWPEYFGTLTAFAQLGQFEAAALLDYDFLAKPLLIISADPTLD-LSFQYAKMLTTMTRRma-tRPPN 437  Eutypa ...
EJP68825           1870 LNQLWKYFQHHIRAWEEYFTTILHVAQLGREECTAILASGYLEKCLRIITADRSMQ-LEPNFVKMLQNVYRRfs-gQAPS 1947 Beauver...
XP_013943732       2146 IDHLWRHFHLHLRSWDEVFGLLLEFAKMGPREVAQLLAHDYLLKLLRIIAADTMTE-LSLNYSKMLQNIYRRl--pRPPP 2222 Trichod...
XP_006968076       2151 FDYIWQHFQFHLRSWDEVFGMMLEFAKLGPREAAHMLANDYLLKLLRIVAADVSME-LPPNYAKMLHSIYRRav-nRPPS 2228 Trichod...
EHK18749           2158 FDRLWRFFQFHLRSWDEVFGMMLQFAQLGPREVAYLLSNDFLLKLLRIIAADASME-LPPNYAKMLHTIYRRpa-nRPPS 2235 Trichod...
XP_003048790       2180 FNHLWNFFHMNLRSWDDCFGAILGFAKLGSREVGYVLAANYLARLLRIISADPAQA-LTGSYQRMLQAVLKRinnaRPPS 2258 [Nectri...
CCT71346           2026 FQHLWKFFHIHIRAWDEYFGAILDFADMGHRETGYVLAANFLASAIRIISADPLQE-LSGNWARMLQSVIRRnnttKPTS 2104 Fusariu...
WGS:ADNJ:MAA_03552 2228 FNHLWRFFYVHIRSWDEYFGTVLAFARLGELEVGHLLADNYLLKLLHIINADPSME-LQPNYQRMVNNLMRRfn-sKPAS 2305 Metarhi...
XP_009657155       2058 FRKIFENFHCNLRSWNECFHLILRFAELGDAETAALLHDDWLKDLMFVIAADANYPgLPEHYVMLVRGLSRRis-nKPPS 2136 Vertici...
ERT01506           2325 FENVIALFGTLLVGMYPSRPQPRTESemYVNDNTNrfslaisdaegdiPMSRTEYLLMgRDWNRDF-GNVFVDKLIAIDQ 2403 Sporoth...
EMR70596            438 YENIINLIDALLDVMDPKFNQSLFVEqsngrft--------lasegtiPFSVNEVNLLhKEWGRNQ-ANIFIEKLIQLDQ 508  Eutypa ...
EJP68825           1948 YVAVLAVIEFLMDRLEPELSHETIVE--AADERLAhsg-------eylPWTAAEVRLLvTHPEEED-SSLFMARLLEIDQ 2017 Beauver...
XP_013943732       2223 YAAILELIDYLIWQLEPLLGTQYIVD--TAEERLNrde-------apfPWTADEVQMIhSHPERQL-GSFFVEKLIAIDQ 2292 Trichod...
XP_006968076       2229 YVSILNLINYLISQLDPTVDAQSIVD--AAEDRLRffe-------ppfPWTSEEVFLIhSHPERQL-ASIFVEKLLGIDQ 2298 Trichod...
EHK18749           2236 YESILKLISYLLSQLESTLGSQYIVD--APEDRLAfhe-------ppfPWTSDEVHLIhHHPDRQL-SSIFVEKLLGIDQ 2305 Trichod...
XP_003048790       2259 YLSVITLVDYLLQQLEPELGADVIVE--DAADRLErme-------rpfSWTSEEVQLVhISLDDTH-GSHFVEKLLGIDQ 2328 [Nectri...
CCT71346           2105 YVSIIRLVSHLMSQMRPQIGTEYIED---PTERVSqla-------eafSWTPEEVDLVySSPNGSY-TSLFVEKLLTLDQ 2173 Fusariu...
WGS:ADNJ:MAA_03552 2306 YTAILALIDYLMAQLEPKLSADVIVD--EAEDRRNark--------pfPWTSEEVQAVhNHPDSPA-TSFFTEKLLETDQ 2374 Metarhi...
XP_009657155       2137 YDVIIQLINHLMKALEPLVQDDMVEE---ANERLAlyled---psqplPWTSEEVNVL-FAEDRDYgGSFFIRRLLEIDQ 2209 Vertici...
ERT01506           2404 NPQATNAIIAHLMATHPAMEAKVYTTLKANVSSNAAAAPQSPFLRATIVFLQNAKSEPLASGMMKHLSEQCRGVAHG-EG 2482 Sporoth...
EMR70596            509 NPIKTDSIVRRIMGLSPLMTRSVFTTLKIGITGQIVTYLITPYLRAAVTFCRNCAEPDLVRLLIRHISLQCRVIQNA-EG 587  Eutypa ...
EJP68825           2018 APEVTRRILKRILRAGEIPTAKLLGMLEQTIRGDATTEPLDSYIRAAAIFVDSCRHLSDAQRLIQHICEQAASFERG-EG 2096 Beauver...
XP_013943732       2293 ARPTTHRILGRLTSLAPQMDMRIFHSLRRKLEADSTMQPMDPFLRAAVQYLESTQSIPHSRNIVRFIALQARSLQNT-EP 2371 Trichod...
XP_006968076       2299 ALEATHGILGRLTALSNQMDQRVFNTLRRRIRGD-TTEPMDPYLRGATTYLEHTPSAGHMQSLMRHIAAQAGGLQSTdEA 2377 Trichod...
EHK18749           2306 AREATHSILGRLTALSTQMDLRVYTTLRRKIQGDTTTEPLDPFLRGASVYLETTLSASHSQNLMRHIAAQAESLHST-EG 2384 Trichod...
XP_003048790       2329 ATRPTDDIIRFLTGIGSTMDGKILATLKRCIRGETSTQAMDPFLRAAGAYIESTEQLDFATKMIQHVYTQAKSLQNT-EG 2407 [Nectri...
CCT71346           2174 EHAGCNNIIRILTKLDSSMDEKVLGTLKLCIRGETSTQAMDPFLRASITYIESTEQLSNAKDMIEHVSMQARSLQNT-EG 2252 Fusariu...
WGS:ADNJ:MAA_03552 2375 APEPTNSIIGRLVESGEELDLRVFNTLRKKIQGETTTQPMDSSIRAAGRYAECSESLERVHILIRHICAQARSLQHN-EG 2453 Metarhi...
XP_009657155       2210 EQQDTCAIICRLAKGDEHMQKCVTRVLGNMISGKAEMHSMVPFLWAALTFVTHCNDPDTSQQVLQHVTQACRVLENN-EG 2288 Vertici...
ERT01506           2483 RMFFETLRGLYHGRTaaTGQVDVKAIIDGLRYIPIWVPGLLCYFDMSVTSHVEAFLQENIFSY-----GPNPQFeedegg 2557 Sporoth...
EMR70596            588 RSFFEFQRDVFDEH---AGATSESVEIQSLETLSEWAPGLLGYLDRTISGEVEAFIQEKLLRH-----GPSPAFgesngg 659  Eutypa ...
EJP68825           2097 EAFLGLMWRAIDSTRl-SEEERGRLRLSTLHTIPSWAPYLLQYADSQVRNGTERLVDMALRLPfesgsTSVEAAa----- 2170 Beauver...
XP_013943732       2372 VAFLEFFSAALNLKRp-DSDIVRAIQSCSLETLPDWVPHLLACGDGGVRYDTVRLLDVELFDQmsntdDVDEDDvsmll- 2449 Trichod...
XP_006968076       2378 KAFLEHFQTALNLKRs-DGEMAQTAEVCSLETLADWVPHLLVFPDGEVRFDTECFLDRELFGPaadspDDDSQRsqer-- 2454 Trichod...
EHK18749           2385 MAFLEHFQASLNLKRk-DGTMAQTTAASSLETLPDWVPHLLAFPDNELRYNTERFLDAVLFSSapnisAEDTTMqdgr-- 2461 Trichod...
XP_003048790       2408 VYFVRFFDTALSLERs-EGEFARTIRSLSLRLVPNWTPHLLAYQESTVRAATENFLDRELFQAlqsesITDRDPed---- 2482 [Nectri...
CCT71346           2253 LYFVQFFRTALDLRQq-DREFCKAVCTFSRDLIPKWVPFLLASPGEQVRRSTHDFLVCELGKIdagatSDRDVTadd--- 2328 Fusariu...
WGS:ADNJ:MAA_03552 2454 STFLGFVDLMLRSCRp-NESLALTRRSYIIQAIPMWAPYLLVYGDEHTRGVTERLINDRLFSPvglnvLDGQDDnaal-- 2530 Metarhi...
XP_009657155       2289 KSFLDFFQRAIQALVcmPLAEAKPGLMMHLELVPLWGPGLIGCVDKRSASLAQQWIEGFLVRYetqwaHEDAELh----- 2363 Vertici...
ERT01506           2558 qeratELVLAVKRLGVEMFQYIQVAFIQRDAPISGTVVGAVQRLMTECV 2606 Sporothrix schenckii ATCC 58251
EMR70596            660 lersrAMNQAARQLAISCLEYLRDTYVSRSAQAARETVLPLDKVIKVCE 708  Eutypa lata UCREL1
EJP68825           2171 -----LSSELALAIGTKCLDFLQHAHVKRRASIERDLAGVLIRVLSNCN 2214 Beauveria bassiana ARSEF 2860
XP_013943732       2450 -errdKLKEIVQKVGRACVFYLRDTHVRQRNQIGRDTALVMVQVTSKCT 2497 Trichoderma atroviride IMI 206040
XP_006968076       2455 ----egsQTIIQRLGISCLQYLRQEHISRRKLIGRESASAVIRVVAKCS 2499 Trichoderma reesei QM6a
EHK18749           2462 ----egtRDVIQRLGIACLLYLRDAHIRRRILIGRDTAVAMVRVVGKCA 2506 Trichoderma virens Gv29-8
XP_003048790       2483 ---reEIKLTVRQLGLTCLGHLEEHHVRRRAHLGRDIAGSFSRVIESCA 2528 [Nectria] haematococca mpVI 77-13-4
CCT71346           2329 ---qvSIRQMTKQIGLICLQYLRDHHVRRRAQMSREIADKFLKVIEGCA 2374 Fusarium fujikuroi IMI 58289
WGS:ADNJ:MAA_03552 2531 --epeTLEHVIRQLGIKCLMYLRDVHVRGRIQLERNAAGNILRVIGYCV 2577 Metarhizium robertsii ARSEF 23
XP_009657155       2364 ----dRLVQAARQLGVGCLQYLQEQYVLAERQVVGSTIEPLHKMIVASE 2408 Verticillium dahliae VdLs.17
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap