Conserved Protein Domain Family
DUF3511

?
pfam12023: DUF3511 
Domain of unknown function (DUF3511)
This presumed domain is functionally uncharacterized. This domain is found in eukaryotes. This domain is about 50 amino acids in length. This domain has two completely conserved residues (Y and K) that may be functionally important.
Statistics
?
PSSM-Id: 403295
View PSSM: pfam12023
Aligned: 55 rows
Threshold Bit Score: 64.908
Threshold Setting Gi: 947085123
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EFH48734      38 NTDPEMKRKRRVASYNLFATEEKLKSTLKNSFKWIKNKFSgdDNSIR 84  Arabidopsis lyrata subsp. lyrata
EEF49942      50 WNAPETKRKKRVAQYKFYAVEGKVKISIKKGFRWFKKTCS--RIVHG 94  castor bean
XP_002319490  47 WNSPETKRKTRVARYKLYAVEGKVKSSIKKGLCWVKRTCY--RIIHl 91  black cottonwood
XP_006382419  35 WNSPETKRKKRVARYKLYAAEGRVKSSVKKGFRWVKKTFS--RFVH- 78  black cottonwood
Q5XVC1        79 WNDPEIKRKRRVAKYKLYSAEGKMKITLRKSYKWIKIQCS--KIIHG 123 thale cress
KRH33844      63 wNHDETKRKRRVAKYQLYETQGKAKSSLKEGFRSIKVTYM--KIVAn 107 soybean
XP_002304103  70 FNDPELKRKRRVANYKVYAMEGKMKGTLRKSIRWIKDTCT--QVVHG 114 black cottonwood
KRH44104      75 FNDPELQRKKRVAGYKIYSVEGKMKGSLRKSLRWIKNTYA--QAVHG 119 soybean
TMW91061      68 LDDLELQRKRRVVGYKAYAMEGKMKGSLRKSFRWIKDTCN--NVVHG 112 Solanum chilense
PHT45876      75 FNDPEMQRKKRVVGYKAYGVEGKMKGSLRKSIKWIKNTCN--HVVHG 119 Capsicum baccatum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap