Conserved Protein Domain Family
DUF3498

?
pfam12004: DUF3498 
Domain of unknown function (DUF3498)
This presumed domain is functionally uncharacterized. This domain is found in eukaryotes. This domain is typically between 433 to 538 amino acids in length. This domain is found associated with pfam00616, pfam00168. This domain has two conserved sequence motifs: DLQ and PLSFQNP.
Statistics
?
PSSM-Id: 403279
View PSSM: pfam12004
Aligned: 24 rows
Threshold Bit Score: 507.385
Threshold Setting Gi: 19571760
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
F6SEU4        718 LNDISTALRNPn-IQRQpsRQSERTRSQpmVLRGPSAEMQg-YMMRDLNSsIDlqsfmarglnssMDMAR-LPSPTKEkp 794  house mouse
XP_008121580  615 LNDISLALRNPh-IQRQpsHQGDRLQAKplILRGPSTDVQssYMMRDLNSsVDmqsymmrginssVDMTR-LPSPTKEkg 692  green anole
CAD27802      608 LGDISRCLATPkpIQQQq-CVQDNSCAHsiST-SLSSGLQ--RIFEDPVD-SH------------SEVLS-VQSSV---- 665  spotted green...
XP_014341095  748 LGDITKSLTNPtpIQQQlrRFMDPSASPnvSG-SVSSGLQ--RIFEDPAD---------------SDVQK-LKSPPQE-- 806  coelacanth
Q9UJF2        609 LADITKSLTNPtpIQQQlrRFTEHNSSPnvSG-SLSSGLQ--KIFEDPTD---------------SDLHK-LKSPSQD-- 667  human
XP_008116004  745 LTDIAKATTNPtpIQQQlrRLADHNSSPn---vSLSSGLQ--KIFEDPTD---------------SEI-K-CKSPPEE-- 800  green anole
XP_016155702  887 LADITKSMTNPtpTQQQlkRFTEHSSSPnvAG-SLSSGLQ--KITEDPTD---------------GDINK-MKSPTQE-- 945  collared flyc...
XP_031588011  611 LGDITRCLAAPtpVQQQlrRFQDHSSAHniSG-SLSSGLQ--RIFEDPSD-SR------------SEVRS-LQTPV---- 669  Oreochromis a...
XP_023820982  611 LGEITQSLAAPtpLPQQlqRFQHHSSAHniTG-SMSSGIQ--RMFEGAAD------------------SHsVHSLQ---- 665  Japanese medaka
XP_017952226  682 LNDISLALRNPh-IQRQpsHQERLPPPKpvILRGPSAELQs-YLVRDLNSs--------------IDMTR-LPSPTKDk- 743  tropical claw...
F6SEU4        795 pppppggGKDLFYV-------SRPPLA-RSSPAYCTSSSDITEPEQKMLSVNKSVSMLDLQgdgpGGRLnsssvsnlaav 866  house mouse
XP_008121580  693 ------sKGDMFFV-------ARPPLA-RSSPAYCTSSSDITEPDQKVLSVNKSVSMLDLQ----DSRMnsisnlhsvgd 754  green anole
CAD27802      666 --------SDVSGR-------SSQRQIpEKPGKPSLSNTPAGSAGTGMPNG-RSRSLVDLQ----DPKNqgpmgpplpea 725  spotted green...
XP_014341095  807 -------NTDVYFW-------SKPPILsQQASTQSMSYSDKDERENVLPNG-RSVSLMDLQ----DSQVahgdrvpvlhd 867  coelacanth
Q9UJF2        668 -------NTDSYFR-------GKTLLLvQQASSQSMTYSEKDERESSLPNG-RSVSLMDLQ----DTHAaqvehasvmld 728  human
XP_008116004  801 -------N-EGYFK-------GN-LLLiQQSSSRSVTYSDKDDETN-LPNV-RSISLMDLQ----DPNAaqcdpssvmqd 858  green anole
XP_016155702  946 -------NVDGHFR-------GKTLLLvQQASTQSMTCSDKDEKVSVLPNG-RSISLMDLQ----DPHTahsdtasmmhd 1006 collared flyc...
XP_031588011  670 -------------R-------GQRPLLaQQHHSNHTSFSDQEEHDTLLPNG-RSISLVDLQ----DAQSlhgntrppphh 724  Oreochromis a...
XP_023820982  666 -----------SAVemmegppQRPLPI-PNG-------GQGQQRDSLLPSG-RSVSLVDLQ----EVRSlqdapqplphh 721  Japanese medaka
XP_017952226  744 ------pSKDMFFV-------SRRPLT-RSSPAYCTSSSDITEPDQKMLSVNKSVSMMDLQ----DSRMnsvtnlqavgd 805  tropical claw...
F6SEU4        867 gdllhssq--------------------asltaalglrpapagrlsQGSGSSItAAGMRLSQMGVTTdGV-----PAqQL 921  house mouse
XP_008121580  755 llnss-------------------------qasitaglglrpsrlsQGSGSSI-AAGLRLSQMGVTTdGLgggtsSAqQL 808  green anole
CAD27802      726 paclrraskas-----------------vpppltycqsalivtepvvhpPHSA-PQVRR-LHATVAQq----------HS 776  spotted green...
XP_014341095  868 mpvrlvg----------------------sqisigqtasvkqlretQSTPQSA-PQIRRPLHPALSQq----------VS 914  coelacanth
Q9UJF2        729 vpirltg----------------------sqlsitqvasikqlretQSTPQSA-PQVRRPLHPALNQp----------GG 775  human
XP_008116004  859 apvrl-------------------------sgsqlsvtqvanikqlQNTPQSA-PQVRRPLHAAVNQq----------GS 902  green anole
XP_016155702 1007 vplrlag----------------------sqlsvtqvatikqlwdtQSTPQSA-PQVRRPLHPAWNQq----------GS 1053 collared flyc...
XP_031588011  725 eapprlsrvgsqasvghavapvtyshsnpltpqpaphqakvpprdgQ--PQSA-PQVRRPLHASVSQq----------RS 791  Oreochromis a...
XP_023820982  722 egpclsrsgsrasisa---aptpaafpssnpvtpalpqskaphkdlQ--PQSA-PQVRR-LQPPLTQq----------RS 784  Japanese medaka
XP_017952226  806 llnss--------------------------qasisgglrpggrlsQGSGSSI-AAGLRLSQMGVTTdGL-----SAqQL 853  tropical claw...
F6SEU4        922 RIPLSFQNPLFHMAA---DGPGPPAGHGgssghgppsshhhhhhhhhhrggEPPGD---TFAPFHGYSKSEDLsSGVPk- 994  house mouse
XP_008121580  809 RIPLSFQNPLFHMAS---DGPAAGGHGGshhphshshs---hshrpaegnpDASAS---TFAPFHGYSKSEDLsSAAAaa 879  green anole
CAD27802      777 LQPLSFQNPVYHLSN--------PAHCLs---------------------tHSSSEnlsTESSHASHSTSDGCsLQAgs- 826  spotted green...
XP_014341095  915 LQPLSFQNPVYQLSN-----PPSSGPKPs---------------------mDSSSEnlsTTSS-RSRSNSEEF------- 960  coelacanth
Q9UJF2        776 LQPLSFQNPVYHLNN-----PIPAMPKAs---------------------iDSSLEnlsTASS-RSQSNSEDF------- 821  human
XP_008116004  903 LQALSFRNPVYHLNN-----PPQPMPKVs---------------------mDSSLEnlsIPSS-RSQ-NSEDL------- 947  green anole
XP_016155702 1054 LRPLSFQNPVYQLNN-----PSPATAKAs---------------------eDSSPEnlsTASS-RSRSNSEDF------- 1099 collared flyc...
XP_031588011  792 LQPLSFQNPVYHLSNpahSMSTRSAHSLr---------------------qDSSSEnlsTESSHNSHSNSDDFgSQVG-- 848  Oreochromis a...
XP_023820982  785 LQPLSFQNPVYHLINpanSLSTRSAHSLr---------------------rDSSSEnlsTESSHNSHSNSDDFgSQEA-- 841  Japanese medaka
XP_017952226  854 RIPLSFQNPLFHMAP---DGPGGPPSHPaph------------------rpDPGAD---AFAPFHGYSKSEDLsSGkhml 909  tropical claw...
F6SEU4        995 --pPAasilhshSYSDEFGPSGT------DFTRRQLSLQdSLQH-----MLSPPQITIGP--Q-RPAPSgpgggsgggsg 1058 house mouse
XP_008121580  880 aaaSNkhiihshSYSDEFTRQGS------EFTKRQLSLQeNLQN-----MLSPPQITIGP--QpQRAPSvata------- 939  green anole
CAD27802      827 -----------sSARELDGKRSDrteessCT---------PGPAgtptaVAVLCQSTAAGtaHiVRVEQqsr-------- 878  spotted green...
XP_014341095  961 ----KlsgpsnsSM-EDFTKRSTqse----dfsRRHTIPdrn-----vpIALQQQSRAGh-aQiRRTDQagl-------- 1017 coelacanth
Q9UJF2        822 ----KlsgpsnsSM-EDFTKRSTqse----dfsRRHTVPdrh-----ipLALPRQNSTGq-aQiRKVDQggl-------- 878  human
XP_008116004  948 ----KlsgpsnsSM-EDFAKRSThse----dfsRQGAILdkh-----mpIALPRQNSTGq-aQiRKTGlg---------- 1002 green anole
XP_016155702 1100 ----KpsgrsnsSL-EDSAKRSSqse----esaRR---Perh-----mpLALPRQNSSSq-aQiRRMEQavl-------- 1153 collared flyc...
XP_031588011  849 ---GKgrapsnsSLDEVGSRRSTqseecsTP--RRHALQ-DLPPgtataVAIPRQSTTAGtaHiIKVEQqsk-------- 914  Oreochromis a...
XP_023820982  842 ---GKacaasnsSLDEGGSRRSTqs--eeYFSPRRLVRP-NLAQsaataVAIPRQSTTTGtaHiVKVEQqsr-------- 907  Japanese medaka
XP_017952226  910 ---------hshSYSDEFSRQG----------KRQLSLQdNLQH-----MLSPPQITIGPgvP-RRQDSq---------- 954  tropical claw...
F6SEU4       1059 ggqpPP--LQRGKSQQLTVSAAQKPRPSSGNlLQSPEPSYGp------aRPRQQSLSKegsiggsggsgggggGGLKPSI 1130 house mouse
XP_008121580  940 gptaPQppLQRGKSQQLTVSAAQKPRPSSGNlLQ-PEVPYGap-----pRGRQQSLAKet------------pSALKPSL 1001 green anole
CAD27802      879 -------aggGARTPRSPSQSASLHSSESSVnTEVMTPG----------HTHQQRHSH---------------VGENPAL 926  spotted green...
XP_014341095 1018 --------scRGKAPNSMVHSTSLRSTGSITgTPVVVPSDTlpn---gsRSRQQSSSSr--------------ESPVPKV 1072 coelacanth
Q9UJF2        879 --------gaRAKAPPSLPHSASLRSTGSMSvVSAALVAEPvqn---gsRSRQQSSSSr--------------ESPVPKV 933  human
XP_008116004 1003 ---------aRVKTPQSLPHSASLRSTGSMSvASATMAAEPvqn---gnRSRQQSSSSr--------------ESPVPKV 1056 green anole
XP_016155702 1154 --------gtRAKTLHTVAHSPSLRSTGSVSgASGAAGTEPvqn---gsRSRHQSSSSr--------------ESPVPKV 1208 collared flyc...
XP_031588011  915 --------ggGARTPRSAAHSASLRSSSSAN-------TEPtptpaagvINRQPSTCSv--------------ENVAPPP 965  Oreochromis a...
XP_023820982  908 -------vggGARTPHSLPVGSSLCSSSSAN--TEPTPTAGp-------SNLQQSSVE---------------------- 949  Japanese medaka
XP_017952226  955 ---pPP--LQRGKSQQLTVQAAHKPRPSSGNlLQSPEPMYGa------aRIRQQSVEKd-------------aGGLKPSI 1010 tropical claw...
F6SEU4       1131 TK---------QH-------------SQT-----PSTLNptmpaseRTVAWVSNMPHLSADIESAHIE--REEYKLKEys 1181 house mouse
XP_008121580 1002 TK---------QQ-------------SHT-----PSTLNpampaseRTVAWVSNMPHLSADIESSHIE--REEYKLKEys 1052 green anole
CAD27802      927 RSask----ppQQ-------------VGSpvevvEAVMSpv----eRTAAWVLN-NSQYEDEES------REEGRNPE-- 976  spotted green...
XP_014341095 1073 RAvhrqmqpsqQQ-------------VQSpv--eSATMSpv----eRTAAWVLN-NGQFEDEEENEQA--RDESKHAE-- 1128 coelacanth
Q9UJF2        934 RAiqr---qqtQQ-------------VQSpv--dSATMSpv----eRTAAWVLN-NGQYEEDVEETEQn-LDEAKHAE-- 987  human
XP_008116004 1057 RAiq-----qqQT-------------QQSpv--dSATMSpv----eRTAAWVLN-NGQYEEEEEDGEQn-QDGTKHAE-- 1108 green anole
XP_016155702 1209 RAiqr---qqtQQ-------------VQSpv--dSATLSpv----eRTAAWVFN-NGQYEDTKRDTAQs-LDEAKHAE-- 1262 collared flyc...
XP_031588011  966 KSttk----qmPQ-------------VASpveavAVAMSpv----eRTAAWVLN-NGQYEEKEEEGGErsRDEGRNTE-- 1021 Oreochromis a...
XP_023820982  950 -----------NVvpptistakapsqVTSpv--eAAVMSpv----eRTAAWVLN-NGQYEEEGGRGGPi-REEGKKTE-- 1008 Japanese medaka
XP_017952226 1011 TK---------QH-------------SHA-----QATLNpvtpaseRTVAWVSNMPHLSADIESAHIE--REEYKLKEys 1061 tropical claw...
F6SEU4       1182 ksmdesrldrvkEYEEEIHSLKERLHMSNRKLEEYERRLLSQEEQTSKILMQYQARLEQSEKRLRQQQVEKDSQIKSIIG 1261 house mouse
XP_008121580 1053 ksmdesrldrvkEYEEEIHSLKERLHMSNRKLEEYERRLLTQEEQTGKILQQYQQRLEQSEKRLRQQQVEKDSQIKSIIG 1132 green anole
CAD27802      977 ------------KYESEIVRLKECLRSSGRRLHQYERRLLAQEQQMQKLLQEYQQRLEDSQERLRRQQEEKDGQMKSIIC 1044 spotted green...
XP_014341095 1129 ------------KYEQEITKLKERLKVSSRRLEEYERRLLAQEQQMQKLLMEYKARLEDSEERLRRQQEEKDSQMKSIIS 1196 coelacanth
Q9UJF2        988 ------------KYEQEITKLKERLRVSSRRLEEYERRLLVQEQQMQKLLLEYKARLEDSEERLRRQQEEKDSQMKSIIS 1055 human
XP_008116004 1109 ------------KYEQEITKLKDRLRVSNRRLEEYEQRLLVQEQQMQKLLMEYKTRLEDSEERLRKQQEEKDSQMKVIIS 1176 green anole
XP_016155702 1263 ------------KYEQEIAKLKERLRVSSRRLEEYERRLLVQEQQMQKLLTDYKSRLEDSEDRLRRQQEEKDSQMKSIIS 1330 collared flyc...
XP_031588011 1022 ------------KYELEISRLKERLRVSGRRLEEYERRLLAQEQQMQKLLHEYKNRLEDSEERLRRQQEEKDTQMKSIIC 1089 Oreochromis a...
XP_023820982 1009 ------------KYELEISRLKECLRASGRRLEEYERRLLAQEQQMKKLMLDYKSRLEDSEERLRRQQEEKDSQMKSIIC 1076 Japanese medaka
XP_017952226 1062 ksmdesrlervkEYEEEIYSLKERLLMSNRKLEEYERRLLTQEEQTNKMMQQYQSRLDQSEKRLRQQQVEKDTQIKSILN 1141 tropical claw...
F6SEU4       1262 RLMLVEEELRRDHPAMAEPLpEPKKRLLDAQERQLPPLGPTNPRVTL 1308 house mouse
XP_008121580 1133 RLMLVEEELRRDHSAAHDAS-ETRKRLLDAQERQLPAVGAANLRLSA 1178 green anole
CAD27802     1045 RLMAVEEELNRDHAEMQLVI-EAKQKIIDAQERRIGSLDAANSRLMT 1090 spotted green pufferfish
XP_014341095 1197 RLMAVEEELKKDHAEMQAVI-DAKQKIIDAQEKRIVSLDAANSRLMS 1242 coelacanth
Q9UJF2       1056 RLMAVEEELKKDHAEMQAVI-DAKQKIIDAQEKRIVSLDSANTRLMS 1101 human
XP_008116004 1177 RLMAVEEELRNDHAEMEAVI-EIKQRIIDAQERRIFSLDRSNTRLTK 1222 green anole
XP_016155702 1331 RLMAVEEELKKDHAEMQAVI-DAKQKIIDAQEKRIVFLDSANTRLMS 1376 collared flycatcher
XP_031588011 1090 RLMAVEEELRRDHAEMQAVI-EAKQKIIDAQEKRIGSLDAANSRLMA 1135 Oreochromis aureus
XP_023820982 1077 RLMAVEEELKRDHAEMQAVI-EAKQKIIDAQEKRIGSLDVANSQLMA 1122 Japanese medaka
XP_017952226 1142 RLMLVEEEIRKDHS--QEPI-DMKRRLIEAQEKKFPSVGTADPRLRL 1185 tropical clawed frog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap