Conserved Protein Domain Family
DUF3490

?
pfam11995: DUF3490 
Domain of unknown function (DUF3490)
This presumed domain is functionally uncharacterized. This domain is found in eukaryotes. This domain is about 160 amino acids in length. This domain is found associated with pfam00225. This domain is found associated with pfam00225. This domain has two conserved sequence motifs: EVE and ESA.
Statistics
?
PSSM-Id: 403272
View PSSM: pfam11995
Aligned: 37 rows
Threshold Bit Score: 247.13
Threshold Setting Gi: 1035998141
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_003534160 778 TFKEQQQEILELWDLCYVSIIHRTQFYLLFKGDPADQIYMEVELRRLTWLQQHLAELGNASpaphvGEEPTISLSSSIRA 857  soybean
BAK06679     725 dFPKKQQEIIELWHECHISIVHRTYFFLLFNGDHTDHIYMEVEHRRLSFIKNSFIA----------DGEPNATVASSLKS 794  domesticated b...
Q651Z7       694 DFERKQQEIIELWHDCNVSIVHRTYFFLLFKGDQTDSIYMEVEHRRLSFIKNSLIA----------DGELHATTASSLRN 763  Japanese rice
ERN16334     793 EFERQRREIIELWHTCHVSLFHRTYFFLLFRGDPADSIYIEVELRRLSFLKNKFADRNPGIlm--lEDGHSMTLAASIRG 870  Amborella tric...
RVW77024     359 mFESQRKQIIMLWYLCHVSIIHRTQFFLLFKGDPADQIYMEVELRRLTWLEQHLAELGNASpa-llGDEPASFVSSSIKA 437  wine grape
KRH19384     768 lFDQQRKQIIMLWHLCHISLVHRTQFFLLLGGDPSDQIYMEVELRRLTRLEQHLAELGNASpa-llGDEPAGSVSASIRA 846  soybean
EFH69259     791 tFIEERQQIIELWHVCHVSIIHRTQFYLLFKGDQADQIYMEVELRRLTWLEQHLAEVGNATpa-rnCDESVVSLSSSIKA 869  Arabidopsis ly...
XP_006341574 778 TFKDQRQQIIDLWDVCYVSIIHRSQFYLLFKGDPADEIYLEVELRRLTWLQQHLAELGNATpa-rvGNEPTVSLSSSIRA 856  potato
XP_015628228 767 lFKEQMQHIIQLWDLCHVSIIHRTQFYLLFRGDRADQIYIEVEVRRLTWLQQHFAEVGDASpa--aGDDSTISLASSIKA 844  Japanese rice
XP_009398104 778 EFEKKQQEIIELWHDCNVSLVHRTYFYMLFKGDPTDSIYMEVELRRLSFLRSNLFQGNVHKa---aALDQRTTSSQSLKL 854  wild Malaysian...
XP_003534160 858 LKREREFLAKRLTTRLSLEEREALYMKWDVPLDGKQRKMQFISKLWTDPHDQIHVQESAEIVARLVGFRTGG-NMSKEMF 936  soybean
BAK06679     795 LRNERDMLYRQMVRKLSLAEKESLYSKWGIERSSKQRRLQLSRLIWTQT-DMEHVRESAELVSKMVQHLERG-QAIKEMF 872  domesticated b...
Q651Z7       764 LRHERDMLYRQMVRKLHLAEKERLYGKWGIDMSTKQRRLQLSRRIWTQT-GMDHVRESAALVAKLVEHLEKG-QAIREMF 841  Japanese rice
ERN16334     871 LRRERESFSRQMKRRLTSQERENLYRKWGIGLETKQRRLQLAQQLWTNPQDMDHVQESATVVARVLGFSESG-QALKEMF 949  Amborella tric...
RVW77024     438 LKQEREYLAKRVSSKLTEEEREMLYIKWEIPAVGKQRRLQLVNKLWTDPHNMEHIKESAEIVAKLVGFCESGeHVSKEMF 517  wine grape
KRH19384     847 LKQEREHLARKVNTKLTAEERELLYAKWEVPPVGKQRRLQFVNKLWTDPYNMQHVQESAEIVAKLIDFSVSD-ENSKDMI 925  soybean
EFH69259     870 LRREREFLAKRVNSRLTPEEREELYMKWDVPLEGKQRKLQFVNKLWTDPYDSRHVQESAEIVAKLVGFCESG-NISKEMF 948  Arabidopsis ly...
XP_006341574 857 IKREREFLAKRLTTRLTAEERDYLYIKWEVPLEGKQRRMQFINKLWTNPHDEKHVKESAEIVAKLVGFCEGG-NMSREMF 935  potato
XP_015628228 845 LRNEREFLARRMGSRLTEEERERLFIKWQVPLEAKQRKLQLVNRLWTDPNDQAHIDESADIVARLVGFCEGG-NISKEMF 923  Japanese rice
XP_009398104 855 LRRERDMLCRQMQKSLSAAERESLYIKWGISLDSKQRRLQLVRHLWSKTKDLEHVRESASVISRVIGLAEQG-QALKEMF 933  wild Malaysian...
XP_003534160 937 ELNFVLP 943  soybean
BAK06679     873 GLSFSLn 879  domesticated barley
Q651Z7       842 GLSFSFK 848  Japanese rice
ERN16334     950 ELSFTPQ 956  Amborella trichopoda
RVW77024     518 ELNFVSH 524  wine grape
KRH19384     926 ELNFSSp 932  soybean
EFH69259     949 ELNFAVP 955  Arabidopsis lyrata subsp. lyrata
XP_006341574 936 ELNFVLP 942  potato
XP_015628228 924 ELNFAVP 930  Japanese rice
XP_009398104 934 GLTFSPQ 940  wild Malaysian banana
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap