4BKW


Conserved Protein Domain Family
DUF3480

?
pfam11979: DUF3480 
Domain of unknown function (DUF3480)
This presumed domain is functionally uncharacterized. This domain is found in eukaryotes. This domain is typically between 350 to 362 amino acids in length. This domain is found associated with pfam01363.
Statistics
?
PSSM-Id: 403258
View PSSM: pfam11979
Aligned: 30 rows
Threshold Bit Score: 381.967
Threshold Setting Gi: 308263581
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4BKW_A        154 LPTPPYLFGILIQKWETPWAKVFPIRLMLRLGAEYRLYPCPLFSVRFRKPLFGETGHTIMNLLADFRNYQYTLPVVQGLV 233 
XP_002114870 1624 IPKSPYLFGLLIHRNELVWARAFPLRLLVGLGNYYKEYPYPIWSYRDRQALFSEIGHTIMRLLIDFDSGQYTLERIPGLI 1703 Trichoplax ad...
FAA00121      351 VQFSSTLFALLISKSEVPWAKLFPTRLLCGLGAQFKYYPCPLVNEKIRKPIYGNIGNTILGILCDFRNYKYQVISVQGMT 430  vase tunicate
XP_001628222  114 LPTVPYVVGVLIQRLEAPWAQLFPLRLMLRLGTEFRYYPCPLWSVRGRPSVYGEIGHTIMNLLTDFKNFQYSIPRVTGLV 193  starlet sea a...
EFX65324      217 LPTPPYLVAVLLQRWEIPWAKVFPLRLLLRLGAEFRYYPCPLFSVRKRKSVFGEVGHTIVNLLADMRNFSYSLPAVAGLV 296  common water ...
XP_008180257  738 LPSPPYLFALLVHQYETPWAKMFPIRLMLRLGAEYRYYPCMLVSIRNRPSLYTEIGQTVIKLLVDFRQYSYGLPTVKGCY 817  pea aphid
XP_002428675  389 LPPPPFLVGILIHKSEIPWARVFPLRLMLRLGAEFRYYPCPLVSVRFREPVYYEVGHTIIKLLADFQNLKYTIPSVRGLR 468  human body louse
EFN80026     1109 LPPAPFLVGLLIHRWETPWAKVFPLRLLLRLGAEYRYYPCPLVSVRFRDALYFEIGHTVMKVLADFRNFGYTLPGVKGLT 1188 Jerdon's jump...
XP_015782796  879 LPSAPFLVGVLIHKFEVPWAKLFPLRLILRLGSKYRCYPCPVVSYRQRRPSYFEIGHTVMDILADFRNFQYTLPVIPGLT 958  two-spotted s...
XP_009013449 1378 LPPPPYLFAVYVHSNELMWAHAFPLRLVFRLGAEFRYYPCPLVSRMNRPAVYGEVGHTIMNLLVDFRNFQYTMNKIDDLV 1457 Helobdella ro...
4BKW_A        234 VDMEVRKTSIKIPSNRYNEMMKAMNKSNEHVLAGGACF---NEKADSHLVCVQN--DDG------NYQTQAIS--IHNQP 300 
XP_002114870 1704 VHLEKRKVTITMAMDQHDKILKVLSKSDERVLAFGANF---SPLADSVLVCTQT---DG------AYKAQIMS--RPGYD 1769 Trichoplax ad...
FAA00121      431 VVVKNSNVTINLPCNRFSDIIKILNSSNDHVLALGADVmasTEYSSSILTCVQNpnDSS-------YQTEV----LHDGP 499  vase tunicate
XP_001628222  194 IHMEETTTTIQLPQDRYDEVNKTQNKARKR---------------------KQHktRPGnvndlqKKKTGKVKn-IQNKA 251  starlet sea a...
EFX65324      297 VHMEEKETNILLPKSRYQQVCKALAQSNDHVISLAASF---SPQADAHLVCLQL--DDG------SYQTQAIN--IHTRP 363  common water ...
XP_008180257  818 IHMDEKQIMVLLPRNRYDQVSRLVLASNRGILAFGANF---SAVADSHLVCVQStkDDG------NYNTQAIN--IHNKP 886  pea aphid
XP_002428675  469 IHMEANQTSILIPKNRYDQVVRALKNSNDPVLALAGCF---SCEADAHLVCMQSkgTEI------TYSTQAIN--INEKP 537  human body louse
EFN80026     1189 IHLKNRTTDVMFPKNRYDQVIKGLHNSNDHVLAYASNF---SISADSHLVCIQT--NTGde---sNYQTQAIN--IHNKP 1258 Jerdon's jump...
XP_015782796  959 IHTEAKRTTVTFPKNRYDKVMKALGSSNEYVLSFGGTF---SLTADSHLTCIQN--DDG------QYHTQTIKlpVNESE 1027 two-spotted s...
XP_009013449 1458 IHVEEKKTTVIVPAYNINQVRKLVSDSDEHVVAISGNF---SSMADSHLVCLQN--SEL------NYQTQAIN--IQGRP 1524 Helobdella ro...
4BKW_A        301 RK---VTGASFFVFSGALKSSSGYLAKSSIVEDGVMVQITAENMDSLRQALREMKDFTITCGKAD--A---------EEP 366 
XP_002114870 1770 RN---TIGANFIVLNCSLKSDSSSRIKTTIVEDGIMMQLNTDANRCIRDAISNMTDCTVE-GHIA------------TND 1833 Trichoplax ad...
FAA00121      500 YEedgSTAASFVVFNGSLKSSHTQLAKSTIVEDGIMVQLLPEKMELLRSALKAMEDFEIDCGHLV--K---------EEE 568  vase tunicate
XP_001628222  252 RK---VTGASFIVLTGSLKTSTPNTAKVSIVEDGLMVQMVPESILALRKALREMHDFTIKTSPST------------SNT 316  starlet sea a...
EFX65324      364 RK---VTGASFLVLNGALKSSSGISGRSSIVEDGVMVQLLPDMLSNLKQALIRMENYTIQCGKII--D---------DQP 429  common water ...
XP_008180257  887 RQ---ITGASFIALNGDLEDE--VSTRWRIVEDGVMVNMSSQKMALLRDALRLMKDFELNCG---------------TND 946  pea aphid
XP_002428675  538 RK---VTGASFVVLNGALKTTSGVAAKTSIIEDGLMVQVPRDTMTSLRNKLRNMEDWSVKCGPIE--G---------RNA 603  human body louse
EFN80026     1259 RT---VTGASFIVINGALKSSMGLSAKSSIVEDGLMVEIMPEKMEALKAALKNMQDFSIGCGRQG--A---------SEP 1324 Jerdon's jump...
XP_015782796 1028 PK---VTGASFIVFSGALKSSTGMLAKMSVVEDGLLVQVTANSLNSLKSSLKDMKDFTIECGKKD--N---------PTS 1093 two-spotted s...
XP_009013449 1525 RS---VTGASFIVFNGALKSSLGMRAKSSIIEDGLMVQLTPDDMVRLKQALLNSTSFTIKCGLLKptDathdagsavADT 1601 Helobdella ro...
4BKW_A        367 QE-------HIHIQWVDDDKN-VSKGVVSPIDGKSMETITNVKIF----HGSEYKANG-KV---IRWTEVFFLENDDQHN 430 
XP_002114870 1834 EApltteddLVVIKWTPSDCT-ANLGVISHVDGMSLAGIKSLDIY----EPVLNKKKS-KTkaaLRWTKLFYLDSGSGGH 1907 Trichoplax ad...
FAA00121      569 KEgehvprtSVCIQWISDDTK-FNIGLSSPIDYRALEGVIGYNIQ----GKSEKKDKH-FI---LRWNQVFFYQCTN--- 636  vase tunicate
XP_001628222  317 VQ-------SVNMVWVSRNVS--SESHVSPIDGTVLTEVPSIRVH----SSCDFTRREvYR---IRWSHVFLKRGIDNPS 380  starlet sea a...
EFX65324      430 EE-------TVTLKWVDQEPSpVNLGVQSPIDGRSFTGISSIRVM----QPRDFKGEGhRL---LRWTELFVIQIEDSAR 495  common water ...
XP_008180257  947 EQ-------TVIFHWTEDDVN-FNIGVKSCIDGRLLDGVYSIRVH----NGVDYSGKR-HF---IRWTEVFVIQCEETSD 1010 pea aphid
XP_002428675  604 EE-------VVKIIWCEDDKN-FNVGVKSVIDNMALDGVPSIRVH----SGKDFMGST-KL---IRWTQVFIIKCEDGAT 667  human body louse
EFN80026     1325 DE-------TVNIKWVDNDTL-FNLGVKSPIDGQPMDGIPSIRVH----NGTDYKGAT-RF---IRWTEVFLIKSDDHSN 1388 Jerdon's jump...
XP_015782796 1094 EE-------SVSLVWGEDDKQ-FNLRVRSCIDGLSLEGIRSIRMY----NGTDFEGDK-FL---IRWVELFLIQNTELPR 1157 two-spotted s...
XP_009013449 1602 DD-------VVEIKWMSTRPD-KTFDIRSPIDGLNLSSYPCVQLHnnsnNKKHLHKSS-KLnldIICVCLYYLHKNQKSS 1672 Helobdella ro...
4BKW_A        431 CLS----DPADHSRLTEHVAKAFCLALCPHLKLLKEDGMTKLGLRVTLDSDQ-VGYQAGSNGQ-PLPSQYMNDLDSALVP 504 
XP_002114870 1908 AEI--------ATTFAEMLAQAIHSALEPSEELFVAKSIREFAVRVTLDGEThTEYKAGYRGQ-PLPEELIEQFDECLIP 1978 Trichoplax ad...
FAA00121      637 -------DATDMGRLAEQMAQGCFQALVPHLSSLRKRGQLKIGIRINVHPDE-VGYSAGSLGV-PLPDKCLKGLDDHLIP 707  vase tunicate
XP_001628222  381 RGV----SSRGLSRLTGDLARACCEALRAHLPGLYEGGRTCLALRVTMDTET-AEYAIGAKQE-PLPAEIMVDLDNALVP 454  starlet sea a...
EFX65324      496 SSSnrieDNGDITRFAETLAKAASVALAAKLASLEPHTL--IGLRVSLDGDS-VEYQAGAGQT-SLPNACVEELDSSLIP 571  common water ...
XP_008180257 1011 RVD----EPLDTSRTAESISKATCTALVPLLDLLSAASLTPLALRIVINPDS-VGYEAGSGQN-KLPPLYMQSLDEHLVP 1084 pea aphid
XP_002428675  668 SAKl--gDPLEVNNLSESIARATCIALIKLLDLLAASGLTILAVRATMDQEN-VGYEAGSNGE-KLAPIYMNSLDNELIP 743  human body louse
EFN80026     1389 GVS----DPVDVSKLSGNIAKATCVALVKLLDLLATAGLTKLGVRATIHPDN-VGYEAGSEGT-KLPPIYMNSLDNELIQ 1462 Jerdon's jump...
XP_015782796 1158 SG-----DGYDAGRAAEIIAQSFCPALVPCLESLVDNKINKIGLRVTLDSDK-IGYDVGSNGS-PLPPNYVDRLDAALVP 1230 two-spotted s...
XP_009013449 1673 PFPsdlsSDAELEKVVGDLIHCCRKAMFAELSTAKCSSHTRVCLRIHVGLDQ-IGYETGTNSSiKLSQSCLFTLDDTIIP 1751 Helobdella ro...
4BKW_A        505 VI 506 
XP_002114870 1979 LL 1980 Trichoplax adhaerens
FAA00121      708 LV 709  vase tunicate
XP_001628222  455 AM 456  starlet sea anemone
EFX65324      572 IL 573  common water flea
XP_008180257 1085 VV 1086 pea aphid
XP_002428675  744 VL 745  human body louse
EFN80026     1463 VL 1464 Jerdon's jumping ant
XP_015782796 1231 II 1232 two-spotted spider mite
XP_009013449 1752 LL 1753 Helobdella robusta
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap