3GOE


Conserved Protein Domain Family
Rad60-SLD

?
pfam11976: Rad60-SLD 
Click on image for an interactive view with Cn3D
Ubiquitin-2 like Rad60 SUMO-like
The small ubiquitin-related modifier SUMO-1 is a Ub/Ubl family member, and although SUMO-1 shares structural similarity to Ub, SUMO's cellular functions remain distinct insomuch as SUMO modification alters protein function through changes in activity, cellular localization, or by protecting substrates from ubiquitination. Rad60 family members contain functionally enigmatic, integral SUMO-like domains (SLDs). Despite their divergence from SUMO, each Rad60 SLD interacts with a subset of SUMO pathway enzymes: SLD2 specifically binds the SUMO E2 conjugating enzyme (Ubc9)), whereas SLD1 binds the SUMO E1 (Fub2, also called Uba2) activating and E3 (Pli1, also called Siz1 and Siz2) specificity enzymes. Structural analysis of Structure 2uyz reveals a mechanistic basis for the near-synonymous roles of Rad60 and SUMO in survival of genotoxic stress and suggest unprecedented DNA-damage-response functions for SLDs in regulating SUMOylation. The Rad60 branch of this family is also known as RENi (Rad60-Esc2-Nip45), and biologically it should be two distinct families SUMO and RENi (Rad60-Esc2-Nip45).
Statistics
?
PSSM-Id: 403255
View PSSM: pfam11976
Aligned: 32 rows
Threshold Bit Score: 59.8822
Threshold Setting Gi: 124445740
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3GOE_A               10 ITLLLRSSKSEDLRLSIPVDFTVKDLIKRYCTEVKISFhERIRLEFEGEWLDPNDQVQSTELEDEDQVSVVL 81  fission yeast
A0C2N0                1 MQIFIKTLAGKKVSYNIEADNTIQQLKMQLQEKEGISS-EQFKLIFKGRHLQEDNKIADAQMQAGDTVHMVI 71  Paramecium tetra...
XP_001706718          6 MQIFVKTLTGKTVTLEVEPTDTINNIKAKIQDKEGIPP-DQQRLIFSGKQLEDNRTLQDYSIQKDATLHLVL 76  Giardia lamblia ...
EAY07345              1 MEIFIKTLTGKHILIHVEPDFLVDDLYRILSGKVGIPA-DQQRLVFNGKQLERGNTLKDYGIQEYSILHLVL 71  Trichomonas vagi...
A0D2P6               10 LNLKVKSQDGEEVFFKIKKQTQFKKLMDAYCSRQNLQI-QNVRFLFDGERILETQTPADIGMETGDEIDVVI 80  Paramecium tetra...
NP_001235208         21 INLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDF-NSIAFLFDGRRLRAEQTPDELEMEDGDEIDAML 91  soybean
XP_011392223         17 LNIKVKDADGNEVFFKVKRTTKLSKLKKAYAERMGKPE-NSVRFIFDGQRIGDNDTAETLGMEDQDEIDAMI 87  Ustilago maydis 521
Q5KL85               25 LNIKITNTNNEEVFFKIKRTTKLNKLKSAYADRVGTDV-ASIRLLFDGHRILDHQTANDLDLEDGDAIEVQL 95  Cryptococcus neo...
WGS:AACS:CC1G_04810  22 INVKVVSASGEEVFFKIKRSTKLSKLQGAYASKVGKDV-NSIRFLYDGSRIQEDDTPASLDMEDNDTIDVMV 92  Coprinopsis cine...
Q4UIN2               19 IQLKVRSPDGSEVYFKIKKKTKLEKLMNTYCSRLGQSP-EAVRFLFDGDRIKGDATPEELGIENGDIIDAMV 89  Theileria annulata
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap